Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU09_1950 (ECU09_1950)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ECU09_1950; Uncharacterized membrane protein ECU09_1950
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Target Names
ECU09_1950
Target Protein Sequence
MDCLRKQAEKIPILDAIEKRMNIRKEYALLGISFFCLVIIMATSLGPLITSTVGIIVPLQ ETLVILRQVNPKKDEAKHMLVFWMVFGILTSLDAYSGAIISFIPLWYTMKFFFLLWAGPL KFRGGIIIYDNILARIPEKWYREEGGIEHAVKKATDAVKTVAESEFNKKDVIESSKKTD
Uniprot No.

Target Background

Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Encephalitozoon cuniculi and how is it classified?

Encephalitozoon cuniculi is an obligate intracellular parasite belonging to the phylum Microsporidia, which comprises more than 1,200 species of spore-forming parasites that infect almost all animal phyla. Although traditionally considered a protozoan parasite, research has demonstrated that microsporidia retain fungal elements and are considered ancestral relatives of zygomycetes .

E. cuniculi has a direct life cycle with both horizontal and vertical (transplacental) transmission. The spore is the infective form, resistant to environmental changes and able to survive up to four weeks at 22°C in dry conditions. Three distinct genotypes of E. cuniculi have been identified based on variations in the internal transcribed spacer (ITS) of rRNA, with genotypes I and III identified in humans .

What are the challenges in working with ECU09_1950 as an uncharacterized membrane protein?

Working with ECU09_1950 presents several challenges typical of membrane proteins:

  • Expression difficulties: Membrane proteins often have hydrophobic regions that can cause toxicity or improper folding when expressed in common prokaryotic systems like E. coli.

  • Solubility issues: The hydrophobic nature of membrane proteins makes them difficult to solubilize without disrupting their native conformation.

  • Purification complexity: Maintaining the structural integrity of membrane proteins during extraction from expression systems requires specialized detergents and buffer conditions.

  • Structural analysis limitations: Membrane proteins are notoriously difficult to crystallize for structural studies.

  • Functional ambiguity: Without known homologs or characterized domains, predicting function becomes challenging .

These challenges require specialized approaches that differ from those used with soluble proteins.

What are the recommended methods for recombinant expression of ECU09_1950?

For successful expression of the ECU09_1950 membrane protein, researchers should consider the following methodological approach:

Expression System Selection:

SystemAdvantagesConsiderations for ECU09_1950
E. coliCost-effective, rapid growthMay require membrane-targeted expression vectors; consider strains optimized for membrane proteins (C41/C43)
Insect cellsBetter for eukaryotic membrane proteinsHigher cost but improved folding; consider Sf9 or High Five™ cells
Mammalian cellsMost native-like post-translational modificationsHighest cost; consider HEK293 or CHO cells for complex membrane proteins
Cell-free systemsAvoids toxicity issuesUseful for difficult-to-express membrane proteins; requires specialized membrane-mimetic components

Expression Optimization Strategy:

  • Clone the ECU09_1950 gene into vectors with different fusion tags (His6, MBP, GST) to improve solubility and purification

  • Test expression at different temperatures (16°C, 25°C, 30°C) to enhance proper folding

  • Use codon-optimized sequences for the chosen expression system to address potential rare codon issues

  • Consider fusion constructs with fluorescent proteins to monitor expression and localization

  • Implement inducible expression systems to control protein production levels

When optimizing expression, it's essential to analyze the protein sequence and secondary structure, particularly focusing on hydrophobic regions that may interfere with proper expression .

What purification strategies are most effective for recombinant ECU09_1950?

Purification of ECU09_1950 requires specialized approaches due to its membrane-bound nature:

Recommended Purification Protocol:

  • Membrane Extraction:

    • Lyse cells using mechanical disruption (sonication or homogenization)

    • Separate membranes by ultracentrifugation (100,000 × g for 1 hour)

    • Solubilize membrane fraction with appropriate detergents

  • Detergent Selection:

    DetergentPropertiesApplication
    DDM (n-Dodecyl β-D-maltoside)Mild, non-ionicGood initial choice for membrane protein extraction
    LMNG (Lauryl maltose neopentyl glycol)StabilizingEffective for maintaining function of membrane proteins
    SMA (Styrene-maleic acid)Polymer-basedExtracts proteins with surrounding lipids as nanodiscs
  • Chromatography Steps:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography to separate protein-detergent complexes

    • Consider ion exchange chromatography as a polishing step

  • Quality Control:

    • SDS-PAGE with Western blotting using anti-His antibodies

    • Mass spectrometry to confirm protein identity

    • Dynamic light scattering to assess homogeneity

For optimal results, consider using vectors with fusion tags on both ends to distinguish full-length proteins from truncated products, especially when working with membrane proteins like ECU09_1950 .

How can researchers verify the structural integrity of purified ECU09_1950?

Verifying the structural integrity of ECU09_1950 is crucial for downstream applications. Multiple complementary techniques should be employed:

Biophysical Characterization Methods:

  • Circular Dichroism (CD) Spectroscopy:

    • Assess secondary structure content (α-helices, β-sheets)

    • Monitor thermal stability through temperature-dependent unfolding

    • Compare spectra with prediction-based secondary structure models

  • Tryptophan Fluorescence Spectroscopy:

    • Probe tertiary structure and conformational changes

    • Assess the environment of tryptophan residues as indicators of proper folding

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Determine the molecular weight of the protein-detergent complex

    • Assess oligomeric state and homogeneity

  • Differential Scanning Fluorimetry (DSF):

    • Measure thermal stability under different buffer conditions

    • Optimize storage conditions by identifying stabilizing additives

  • Cryo-Electron Microscopy:

    • For structural characterization if sufficient quantity and quality can be obtained

    • Particularly valuable for membrane proteins resistant to crystallization

Researchers should note that membrane proteins like ECU09_1950 are typically more stable when surrounded by lipids or appropriate detergents that mimic their native environment .

How can researchers investigate the potential role of ECU09_1950 in E. cuniculi pathogenesis?

To investigate the role of ECU09_1950 in pathogenesis, researchers should adopt a multi-faceted approach:

Investigation Strategy:

  • Localization Studies:

    • Generate antibodies against ECU09_1950 or use epitope-tagged constructs

    • Perform immunofluorescence microscopy to determine subcellular localization during infection

    • Use immuno-electron microscopy to precisely locate the protein within parasite structures

  • Host-Parasite Interaction Assays:

    • Assess binding of purified ECU09_1950 to host cell components

    • Conduct pull-down assays to identify potential host receptors or binding partners

    • Investigate whether ECU09_1950 is exposed on the parasite surface using surface biotinylation

  • Functional Knockdown/Knockout:

    • Develop genetic manipulation tools for E. cuniculi (challenging but potentially achievable)

    • Consider heterologous expression in related organisms with established genetic systems

    • Use RNA interference if applicable to microsporidian systems

  • Infection Models:

    • Test whether recombinant ECU09_1950 affects host cell function in vitro

    • Assess antibodies against ECU09_1950 for their ability to block infection

    • Consider animal models to evaluate the role in vivo

When designing these experiments, researchers should note that E. cuniculi primarily targets the central nervous system, kidneys, and eyes, where it causes chronic inflammation and granulomas .

How might ECU09_1950 contribute to immune evasion in E. cuniculi infection?

ECU09_1950's potential role in immune evasion can be investigated through the following approaches:

Immune Response Investigation:

  • Interaction with Host Immune Components:

    • Test ECU09_1950 binding to complement factors

    • Assess effects on antigen presentation pathways

    • Investigate interactions with pattern recognition receptors

  • Effects on Immune Cell Function:

    • Measure changes in cytokine production by immune cells exposed to ECU09_1950

    • Assess impact on phagocytosis efficiency

    • Determine effects on immune cell migration and activation

  • Comparative Analysis Across Strains:

    • Compare ECU09_1950 sequence and expression across the three E. cuniculi genotypes

    • Correlate variations with differences in virulence or host specificity

    • Assess whether sequence polymorphisms affect immune recognition

This research direction is particularly important given that cell-mediated immunity is the principal protective mechanism against E. cuniculi infection, involving CD4+ and CD8+ T lymphocytes, with CD8+ T cells becoming more predominant 6-8 weeks post-infection .

What approaches can determine the membrane topology and structural features of ECU09_1950?

Determining the membrane topology of ECU09_1950 is crucial for understanding its function:

Structural Analysis Methods:

  • Computational Prediction:

    • Use multiple membrane protein topology prediction algorithms (TMHMM, Phobius, TOPCONS)

    • Apply hydropathy analysis to identify transmembrane regions

    • Predict secondary structure elements using tools like PSIPRED

  • Experimental Topology Mapping:

    • Implement cysteine scanning mutagenesis with membrane-impermeable labeling reagents

    • Use limited proteolysis combined with mass spectrometry

    • Apply glycosylation mapping with engineered N-linked glycosylation sites

  • Advanced Structural Techniques:

    • Solid-state NMR spectroscopy for membrane-embedded structure

    • Electron crystallography if 2D crystals can be formed

    • Single-particle cryo-electron microscopy for larger complexes

    • X-ray crystallography if the protein can be successfully crystallized

  • Molecular Dynamics Simulations:

    • Model ECU09_1950 in a lipid bilayer environment

    • Simulate conformational dynamics to identify flexible regions

    • Predict potential binding sites or functional domains

These approaches would provide valuable insights into the structural features that might mediate interactions with host components or contribute to parasite survival mechanisms.

How does ECU09_1950 compare to membrane proteins from other microsporidian species?

Comparative analysis of ECU09_1950 can provide evolutionary and functional insights:

Comparative Analysis Strategy:

  • Sequence-Based Comparisons:

    • Perform BLAST searches against other microsporidian genomes

    • Conduct multiple sequence alignments to identify conserved residues

    • Calculate evolutionary rates to identify regions under selection pressure

  • Phylogenetic Analysis:

    • Construct phylogenetic trees of homologous proteins

    • Compare with species phylogeny to identify potential horizontal gene transfer events

    • Analyze patterns of sequence conservation in the context of host specificity

  • Domain Architecture Analysis:

    • Identify conserved domains or motifs across species

    • Compare transmembrane topology predictions

    • Assess conservation of post-translational modification sites

  • Expression Pattern Comparison:

    • Compare expression levels across different developmental stages

    • Analyze regulation patterns in different host environments

    • Assess correlation between expression and virulence potential

This comparative approach may reveal whether ECU09_1950 represents a core microsporidian protein or a species-specific adaptation in E. cuniculi, potentially providing clues about its functional significance .

What can researchers learn from studying ECU09_1950 in different E. cuniculi strains?

Investigating strain variations in ECU09_1950 can provide valuable insights:

Strain Variation Analysis:

  • Genotype-Specific Variations:

    • Compare ECU09_1950 sequences across the three established E. cuniculi genotypes (I, II, and III)

    • Correlate sequence variations with host specificity (genotypes I and III have been identified in humans)

    • Assess polymorphisms in relation to potential functional domains

  • Expression Analysis:

    • Quantify expression levels across different strains

    • Determine if expression correlates with virulence differences

    • Analyze regulatory regions for strain-specific variations

  • Functional Implications:

    • Test strain-specific variants for differences in host cell binding

    • Assess immunogenicity differences between variants

    • Evaluate structural consequences of amino acid substitutions

This research direction is particularly relevant given that E. cuniculi isolates differ in the number of GTTT repeats in the internal transcribed spacer (ITS) of rRNA and show variation in genes encoding structural proteins like polar tube protein (PTP) and spore wall protein (SWP-1) .

How might ECU09_1950 be utilized in developing diagnostic tools for E. cuniculi infections?

ECU09_1950 could potentially serve as a target for developing improved E. cuniculi diagnostics:

Diagnostic Development Strategy:

  • Serological Assay Development:

    • Express and purify recombinant ECU09_1950 for antibody detection

    • Develop ELISA, immunofluorescence, or lateral flow assays

    • Assess sensitivity and specificity compared to existing serological tests

  • PCR-Based Detection:

    • Design PCR primers targeting the ECU09_1950 gene

    • Develop quantitative PCR assays for parasite burden assessment

    • Create multiplex PCR systems to distinguish between E. cuniculi genotypes

  • Validation Studies:

    • Test assays using clinical samples from confirmed cases

    • Compare performance against established methods like protein electrophoresis

    • Evaluate utility for monitoring treatment response

  • Point-of-Care Applications:

    • Adapt successful assays to field-deployable formats

    • Optimize for resource-limited settings

    • Assess stability and shelf-life of diagnostic reagents

Current serological diagnosis of E. cuniculi relies on detecting IgG and IgM antibodies but cannot easily distinguish between active, early, reactivated, or chronic infection. A targeted approach using specific proteins like ECU09_1950 might improve diagnostic specificity .

What considerations are important when designing inhibitors targeting ECU09_1950?

For researchers exploring ECU09_1950 as a potential therapeutic target:

Drug Development Considerations:

  • Target Validation:

    • Confirm membrane accessibility of the protein

    • Determine essentiality for parasite survival

    • Identify functional domains as potential binding sites

  • Structural Analysis for Drug Design:

    • Identify potential ligand-binding pockets

    • Perform molecular docking studies with virtual compound libraries

    • Design structure-based inhibitors if crystal structure becomes available

  • Screening Approaches:

    • Develop in vitro binding assays for high-throughput screening

    • Establish functional assays if the protein's activity is characterized

    • Implement phenotypic screening using E. cuniculi cultures

  • Selectivity Considerations:

    • Compare with host homologs to minimize off-target effects

    • Assess cross-reactivity with related microbial species

    • Evaluate potential for resistance development

  • Delivery Challenges:

    • Address the need for inhibitors to cross host cell membranes

    • Consider formulation strategies for intracellular delivery

    • Evaluate blood-brain barrier penetration for CNS infections

When developing therapeutics, researchers should consider that E. cuniculi primarily affects the CNS, kidneys, and eyes, with pathology related to chronic inflammation and granuloma formation in these organs .

How can researchers overcome difficulties in expressing full-length ECU09_1950?

Expression of full-length membrane proteins like ECU09_1950 presents specific challenges:

Troubleshooting Strategies:

  • Sequence Optimization:

    • Analyze for rare codons and optimize for expression system

    • Check for hydrophobic regions that may cause aggregation

    • Identify potential protease cleavage sites that might lead to degradation

  • Expression System Modifications:

    • Use specialized strains designed for membrane proteins (e.g., C41/C43 for E. coli)

    • Consider cell-free expression systems with added lipids or detergents

    • Test eukaryotic expression systems for a protein of eukaryotic origin

  • Construct Engineering:

    • Design fusion constructs with solubilizing partners (MBP, SUMO, etc.)

    • Create truncated constructs excluding problematic regions

    • Use dual-tagging strategies to identify and purify full-length protein

  • Expression Conditions:

    • Reduce expression temperature to slow folding and prevent aggregation

    • Test various induction conditions (concentration, timing, duration)

    • Include specific additives that may stabilize the protein during expression

  • Directed Evolution Approaches:

    • Apply random mutagenesis to identify variants with improved expression

    • Screen for mutants with enhanced stability while maintaining function

    • Develop selection systems based on proper membrane insertion

These approaches align with general strategies for challenging membrane proteins while addressing the specific properties of ECU09_1950 .

What methodological approaches can resolve contradictory experimental results with ECU09_1950?

When faced with contradictory results in ECU09_1950 research:

Resolution Strategy:

  • Systematic Validation:

    • Implement multiple orthogonal techniques to verify findings

    • Examine experimental conditions that might explain differences

    • Test reagent specificity and validate antibodies

  • Reproducibility Enhancement:

    • Standardize protocols across laboratories

    • Implement blinded analysis where appropriate

    • Increase sample sizes and biological replicates

  • Advanced Analysis Techniques:

    • Apply mixed methods research design combining qualitative and quantitative approaches

    • Use statistical frameworks specifically designed for reconciling contradictory results

    • Implement triangulation from multiple data sources

  • Collaborative Approaches:

    • Establish multi-laboratory validation studies

    • Create shared repositories of reagents and protocols

    • Develop consensus guidelines for ECU09_1950 research methods

  • Reporting Transparency:

    • Document all experimental conditions thoroughly

    • Report negative and contradictory results

    • Share raw data and analysis pipelines

This methodological framework draws on established approaches in resolving contradictions in biological research, applying concepts from qualitative comparative analysis and mixed methods research design .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.