Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU10_0880 (ECU10_0880)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request and incurs an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type in your order; we will prioritize its inclusion in the manufacturing process.
Synonyms
ECU10_0880; Uncharacterized membrane protein ECU10_0880
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Target Names
ECU10_0880
Target Protein Sequence
MEGIKFADVLRSFEKKAEDDEYVSVERDYNERKVIENDVRRTELLGVDKRNRKVIKVLKR LLFVELDKIPIKYTQGMSEIASVFVLYYFQNIVEEEVAKGVLASGSDEESAEESAADGFS EQFIEAPEDENVELKRFVSRHKDTTAILGIVLTNVFRRKLEPLVVDDFKLYKENMRIFVE MMKKKGIRIPELESYKFMGSILTFFLRNLSRMEDVHKVFEIILSCPNTCPFLLLVLFYDK ISNGKTIDSIVNNDLFPKVVKLEEEFVETKKRVESRSGFSRMRVMLVGGIASIVAAVVVY KITKKE
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Encephalitozoon cuniculi and why is it significant for research?

Encephalitozoon cuniculi is a microsporidian parasite belonging to a phylum of obligate intracellular eukaryotic pathogens. It has significant research value for several reasons:

  • It serves as a model organism for studying microsporidian biology and host-pathogen interactions

  • Its compact genome provides advantages for genomic and proteomic studies

  • The unique invasion mechanism involving polar tube proteins represents a specialized biological system with potential therapeutic targeting opportunities

Methodologically, E. cuniculi can be cultured in vitro using cell lines such as RK13 (rabbit kidney cells) maintained in minimum essential medium (MEM) supplemented with 7% fetal calf serum and 1% penicillin-streptomycin-amphotericin B. Infected flasks typically require subpassaging every 3 weeks, with supernatants containing microsporidian spores collected twice weekly .

What is currently known about the structure and function of ECU10_0880?

ECU10_0880 remains largely uncharacterized, though several structural features can be inferred:

  • It is classified as a membrane protein in Encephalitozoon cuniculi strain GB-M1

  • The UniProt accession number is Q8SUE5

  • The full amino acid sequence is 306 amino acids in length

  • The protein likely contains transmembrane domains based on sequence analysis

The amino acid sequence (MEGIKFADVLRSFEKKAEDDEYVSVERDYNERKVIENDVRRTELLGVDKRNRKVIKVLKRLLFVELDKIPIKYTQGMSEIASVFVLYYFQNIVEEEVAKGVLASGSDEESAEESAADGFSEQFIEAPEDENVELKRFVSRHKDTTAILGIVLTNVFRRKLEPLVVDDFKLYKENMRIFVEMMKKKGIRIPELESYKFMGSILTFFLRNLSRMEDVHKVFEIILSCPNTCPFLLLVLFYDKISNGKTIDSIVNNDLFPKVVKLEEEFETKRRVESRSGFSRMRVMLVGGIASIVAAVVVYKITKKE) contains regions that suggest potential membrane association and protein-protein interaction domains .

What are the optimal storage and handling conditions for recombinant ECU10_0880?

For maximum stability and functionality, recombinant ECU10_0880 should be handled according to these guidelines:

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized specifically for this protein

  • Storage temperature: Store at -20°C; for extended storage, conserve at -20°C or -80°C

  • Working aliquots can be maintained at 4°C for up to one week

  • Repeated freezing and thawing should be avoided to maintain protein integrity

Researchers should prepare small working aliquots upon receipt to minimize freeze-thaw cycles and consider adding protease inhibitors when working with the protein for extended periods in experimental settings.

What detection methods can be used to verify ECU10_0880 in experimental samples?

Several complementary techniques can be employed to detect and verify ECU10_0880:

TechniqueApplicationConsiderations
Western blotProtein identification and size verificationRequires specific antibodies or tag detection
ELISAQuantitative detectionCan be used for screening hybridomas and samples
Indirect immunofluorescence (IFAT)Localization in cells/tissuesRequires optimization of fixation and permeabilization
Mass spectrometryProtein identification and modification analysisCan identify specific peptide sequences unique to ECU10_0880

When developing detection methods, researchers should include appropriate controls and validate specificity, particularly when working with antibodies developed against this relatively uncharacterized protein .

What experimental approaches are recommended for investigating ECU10_0880's potential role in Encephalitozoon cuniculi biology?

To elucidate ECU10_0880's biological function, researchers should consider multi-faceted experimental designs:

  • Subcellular localization studies using immunofluorescence and immunoelectron microscopy techniques, similar to those successfully employed with Encephalitozoon polar tube proteins

  • Protein-protein interaction studies including:

    • Yeast two-hybrid analysis to identify binding partners

    • Cross-linking experiments to capture protein complexes

    • Co-immunoprecipitation to confirm interactions in native conditions

  • Temporal expression analysis during different stages of the parasite life cycle

  • Comparative analysis with homologous proteins in related microsporidian species

These approaches should be conducted with rigorous controls and multiple biological replicates to ensure reproducibility and reliability of results .

How can researchers optimize immunolocalization studies for ECU10_0880?

Based on successful approaches with other Encephalitozoon proteins, researchers should consider these methodological optimizations:

  • Antibody development strategies:

    • Develop multiple monoclonal antibodies targeting different epitopes

    • Characterize antibody isotypes (e.g., IgG2a, IgG3, IgM) to select optimal performers

    • Validate specificity against recombinant protein and in biological samples

  • Sample preparation protocols:

    • Test multiple fixation methods (e.g., formalin, ethanol)

    • Optimize permeabilization for membrane protein accessibility

    • Consider comparison with established staining methods such as Calcofluor, Modified Trichrome, and Gram-chromotrope

  • Microscopy techniques:

    • Combine IFAT with other staining methods for co-localization studies

    • Implement super-resolution microscopy for detailed localization

    • Use Z-stack imaging for three-dimensional localization

The research by Moura et al. demonstrates that monoclonal antibodies with different isotypes showed variable reactivity patterns against spore wall components versus internal structures, suggesting that careful antibody selection is critical for successful immunolocalization .

What are the methodological considerations for protein-protein interaction studies involving ECU10_0880?

When investigating potential interaction partners of ECU10_0880, researchers should implement these methodological considerations:

  • Yeast two-hybrid analysis:

    • Test both full-length ECU10_0880 and domain fragments

    • Consider membrane protein limitations in traditional Y2H systems

    • Use specialized membrane Y2H systems if available

    • Include both positive and negative controls to validate interactions

  • Cross-linking approaches:

    • Optimize cross-linker type, concentration, and reaction conditions

    • Consider the membrane environment's effect on cross-linking efficiency

    • Follow with mass spectrometry to identify interaction partners

    • Validate with complementary techniques

  • Co-immunoprecipitation:

    • Carefully select detergents for membrane protein solubilization

    • Optimize buffer conditions to preserve native interactions

    • Include appropriate controls to identify non-specific binding

    • Consider quantitative approaches to assess interaction strength

The successful identification of protein complexes between EcPTP1, EcPTP2, and EcPTP3 in E. cuniculi provides a methodological blueprint that can be adapted for ECU10_0880 studies .

What challenges might researchers face when expressing recombinant ECU10_0880 and how can these be addressed?

Expression of recombinant membrane proteins presents several technical challenges that researchers should anticipate:

  • Expression system selection:

    • Bacterial systems: May require optimization of codon usage and growth temperature

    • Eukaryotic systems: Consider yeast, insect, or mammalian cells for proper folding

    • Cell-free systems: Useful for toxic membrane proteins

  • Solubilization strategies:

    • Screen multiple detergents for extraction efficiency

    • Consider nanodisc or liposome reconstitution for functional studies

    • Optimize buffer composition for stability

  • Purification optimization:

    • Implement multi-step purification protocols

    • Monitor protein quality at each step

    • Validate final product using multiple techniques

  • Functional validation:

    • Develop activity assays if function becomes known

    • Assess proper folding through biophysical techniques

    • Compare with native protein when possible

A systematic approach to optimization with careful documentation of conditions is essential for reproducible recombinant protein expression.

How can mass spectrometry contribute to ECU10_0880 characterization?

Mass spectrometry offers powerful approaches for detailed characterization of ECU10_0880:

  • Protein identification and validation:

    • Peptide mass fingerprinting to confirm identity

    • Sequence coverage analysis to verify expression of full-length protein

    • Detection of post-translational modifications

  • Structural characterization:

    • Hydrogen-deuterium exchange MS for topology studies

    • Limited proteolysis coupled with MS for domain mapping

    • Cross-linking MS for proximity relationships

  • Interaction studies:

    • Immunoprecipitation followed by MS (IP-MS)

    • Proximity labeling approaches coupled with MS

    • Quantitative comparison between conditions

  • Comparative proteomic analysis:

    • Expression profiling during different life cycle stages

    • Comparison between wild-type and treated samples

    • Analysis across different microsporidian species

Proteomic studies similar to those that identified Spore Wall Protein 1 (SWP1) as an antigenic target in E. intestinalis could provide valuable insights into ECU10_0880 function and localization .

What experimental design principles should guide ECU10_0880 research?

Effective experimental design for ECU10_0880 research should incorporate these principles:

  • Clear hypothesis formulation:

    • Develop specific, testable hypotheses about ECU10_0880 function

    • Design experiments that can directly address these hypotheses

    • Consider alternative explanations for predicted outcomes

  • Appropriate controls:

    • Include positive controls (known membrane proteins)

    • Incorporate negative controls (buffer-only, irrelevant proteins)

    • Implement internal controls for normalization

  • Statistical considerations:

    • Determine appropriate sample sizes through power analysis

    • Plan appropriate statistical tests based on data distribution

    • Consider multiple hypothesis testing corrections

  • Validation strategies:

    • Use multiple complementary techniques

    • Replicate key findings independently

    • Test findings across different biological contexts

As noted in experimental design literature, understanding the data through careful planning is essential for knowledge discovery and decision-making in research projects .

How should researchers approach contradictory data in ECU10_0880 studies?

When faced with contradictory results in ECU10_0880 research, implement this methodological framework:

  • Data validation:

    • Verify technical reproducibility of each contradictory finding

    • Assess reagent quality and experimental conditions

    • Review raw data for potential analytical errors

  • Hypothesis refinement:

    • Consider whether contradictions suggest multiple functions or contexts

    • Develop new hypotheses that might explain seemingly contradictory results

    • Design experiments specifically to resolve contradictions

  • Methodological evaluation:

    • Compare methodological differences between contradictory studies

    • Assess whether different methods might detect different aspects of ECU10_0880

    • Implement standardized protocols when possible

  • Collaborative resolution:

    • Engage with other researchers in the field

    • Consider blind replication studies

    • Share detailed protocols and reagents to facilitate reproducibility

Contradictions often lead to deeper understanding when approached systematically rather than dismissed.

What are the key considerations for developing antibodies against ECU10_0880?

Development of effective antibodies against ECU10_0880 requires careful planning:

  • Immunization strategy selection:

    • Multiple immunization protocols with and without adjuvants

    • Purified recombinant protein versus synthetic peptides

    • Consider immunization schedules (e.g., days 0, 7, 21, 35, and 42)

  • Screening approach:

    • Implement multiple screening methods (ELISA, IFAT)

    • Select hybridomas based on specific criteria (e.g., optical density ≥0.5)

    • Clone positive hybridomas by limiting dilution

  • Characterization requirements:

    • Determine antibody isotypes (IgG2a, IgG3, IgM, etc.)

    • Assess reactivity patterns against different parasite structures

    • Test cross-reactivity with related proteins and species

  • Application-specific validation:

    • Optimize antibodies for specific applications (Western blot, IFAT, etc.)

    • Validate in relevant biological samples

    • Document specificity and sensitivity parameters

The successful development of monoclonal antibodies against E. intestinalis demonstrates that careful attention to immunization protocols and comprehensive screening approaches can yield antibodies with specific reactivity patterns useful for different experimental applications .

What reproducibility practices should be implemented in ECU10_0880 research?

To ensure reproducible research with ECU10_0880, implement these practices:

  • Comprehensive documentation:

    • Maintain detailed laboratory notebooks

    • Record all experimental parameters and reagent information

    • Document equipment settings and calibration status

  • Standardized reporting:

    • Follow field-specific reporting guidelines

    • Include all relevant metadata

    • Provide access to raw data when possible

  • Quality control implementation:

    • Establish acceptance criteria for experiments

    • Regularly test reagent quality

    • Maintain reference standards across studies

  • Validation framework:

    • Use multiple complementary techniques

    • Implement both technical and biological replicates

    • Consider independent validation by different researchers

Adherence to these practices will strengthen the reliability and impact of ECU10_0880 research findings.

What approaches are recommended for quantitative analysis of ECU10_0880 experiments?

Quantitative analysis of ECU10_0880 experiments should follow these guidelines:

  • Image analysis for localization studies:

    • Use standardized image acquisition parameters

    • Implement automated analysis workflows where possible

    • Quantify signal intensity, distribution, and co-localization

    • Apply appropriate statistical tests to compare conditions

  • Interaction strength quantification:

    • Consider binding kinetics measurements (kon, koff, KD)

    • Implement relative quantification in co-immunoprecipitation

    • Use competition assays to assess specificity

    • Apply appropriate normalization to account for expression levels

  • Expression level analysis:

    • Select appropriate reference genes for normalization

    • Consider both relative and absolute quantification approaches

    • Implement statistical tests appropriate for the data distribution

    • Account for technical and biological variation

  • Structure-function correlation:

    • Systematically analyze mutant variants

    • Correlate structural features with functional outcomes

    • Implement multivariate analysis for complex datasets

These approaches should be tailored to the specific experimental questions and adapted as new information about ECU10_0880 emerges.

How can researchers integrate findings about ECU10_0880 into broader understanding of Encephalitozoon biology?

To contextualizing ECU10_0880 within broader Encephalitozoon biology:

  • Comparative analysis approaches:

    • Compare with known proteins in other microsporidian species

    • Analyze evolutionary conservation patterns

    • Consider functional parallels with better-characterized proteins

  • Systems biology integration:

    • Map potential interactions with known pathways

    • Consider potential roles in infection mechanisms

    • Integrate with transcriptomic and proteomic datasets

  • Host-pathogen interaction framework:

    • Investigate potential roles in host cell recognition

    • Consider involvement in immune evasion

    • Assess contribution to parasite survival and replication

  • Translational perspectives:

    • Evaluate potential as diagnostic marker

    • Consider as potential therapeutic target

    • Assess relevance to microsporidian infections in immunocompromised hosts

This integrated approach will help position specific findings about ECU10_0880 within the broader context of microsporidian biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.