Recombinant Encephalitozoon intestinalis Aquaporin (AQP)

Shipped with Ice Packs
In Stock

Description

Water Permeability

While direct functional data for E. intestinalis AQP is limited, studies on its ortholog in Encephalitozoon cuniculi (EcAQP, UniProt Q8SRK2) demonstrate:

  • Osmotic water permeability in Xenopus oocytes

  • No glycerol or urea transport activity

  • Mercury-insensitive channel (due to absent cysteine residues near NPA motifs)

Comparative Analysis with E. cuniculi AQP

FeatureE. intestinalis AQP E. cuniculi AQP
Length251 residues250 residues
Key Sequence VariationS15 vs. T15 in N-terminalDistinct C-terminal residues
Conserved RegionsNPA motifs, aromatic/arginine selectivity filterIdentical pore architecture

Experimental Use Cases

  • Membrane protein crystallization: High-purity (>90%) preparation enables structural studies

  • Pathogen physiology studies: Investigates water regulation in microsporidian spores during host infection

  • Drug target validation: Serves as a model for anti-microsporidian agent development

Technical Notes

  • Reconstitution: Requires 0.1-1.0 mg/mL concentration in deionized water with 5-50% glycerol for stability

  • Activity assays: Recommended protocols include:

    1. Osmotic swelling assays in liposomes

    2. Stopped-flow spectroscopy

    3. Planar lipid bilayer electrophysiology

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
AQP; Aquaporin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Encephalitozoon intestinalis (Microsporidian parasite)
Target Names
AQP
Target Protein Sequence
MAKEALKTLQSMFGEMVASFVFGFAVYSAILGSSISQSSADKVIVGLTVGFSGIGVIYSFCDVTIAHFNPAITLAAILTSKIDVLQGLGYMLAQYIGFMLAVCALLVCSPVEYKETLDTIRPGPTDFGATSLNVFFAEFFLTAIFVHIVFATAVNPYKPKVDTEGKFVDPDEKEPVDRRITAPLCIGLTLGFLAFMGLASSGGAFNPGLTFAPMAMSNTWSHFWIYLGGQYLGGLTGGLLQVLVLYKLSSD
Uniprot No.

Target Background

Function
Aquaporin is a water channel protein that facilitates the transport of water across cellular membranes. It plays a crucial role in osmotolerance, the ability of organisms to survive in environments with varying water concentrations.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Encephalitozoon intestinalis Aquaporin and what is its functional significance?

Encephalitozoon intestinalis Aquaporin is a transmembrane channel protein that facilitates the rapid influx of water across cell membranes in this microsporidian pathogen. Microsporidia are obligate intracellular parasites that depend on water influx during their germination process. The aquaporin in E. intestinalis, similar to the characterized E. cuniculi AQP (EcAQP), likely facilitates this critical water movement during the infectious process .

Functionally, microsporidian AQPs appear to be orthodox aquaporins that selectively transport water but not other solutes like glycerol or urea, as demonstrated in studies with EcAQP . This functional specialization is particularly important during spore germination, a process dependent on rapid water influx that creates the hydrostatic pressure needed for polar tube extrusion during host cell infection .

How can recombinant E. intestinalis AQP be expressed and purified for research purposes?

Expression of recombinant microsporidian AQPs can be achieved using several systems:

  • Xenopus oocyte expression system: This is commonly used for functional characterization of AQPs. The procedure involves:

    • Amplifying the AQP gene using PCR with specific primers designed to incorporate appropriate restriction sites

    • Cloning the amplicon into an expression vector (e.g., pGEMHE for Xenopus systems)

    • Linearizing the plasmid and generating cRNA using in vitro transcription

    • Microinjecting the cRNA into Xenopus oocytes for expression

  • Bacterial expression systems: For protein purification:

    • Cloning the AQP gene into a bacterial expression vector with a histidine or other affinity tag

    • Transforming E. coli (e.g., strain DH5α)

    • Inducing protein expression and purifying using affinity chromatography

For quality control, restriction digestion analysis and sequencing should be used to confirm the identity of the expression constructs before proceeding with expression .

What experimental methods are used to assess AQP function in microsporidia?

The functional characterization of microsporidian AQPs employs several methodologies:

  • Xenopus oocyte swelling assay: This is the gold standard for AQP functional characterization. Oocytes expressing the recombinant AQP are subjected to hypotonic conditions, and the rate of swelling is measured to determine osmotic water permeability (Pf) .

  • Mercury sensitivity testing: Pre-treating AQP-expressing oocytes with HgCl₂ before the swelling assay helps determine if the AQP is mercury-sensitive, which relates to the presence of specific cysteine residues near the NPA motifs .

  • Solute permeability assays: Testing permeability to solutes like glycerol or urea can help classify the AQP as either an orthodox aquaporin (water-specific) or an aquaglyceroporin (permeable to water and small uncharged solutes) .

  • Inhibition studies: Using various potential inhibitors of AQP function, such as gold and silver salts, which can provide insights into functional characteristics and potential therapeutic targets .

Assay TypeMeasurementInterpretation
Oocyte swellingOsmotic water permeability (Pf, μm/s)Higher values indicate greater water transport capacity
Mercury sensitivityChange in Pf after HgCl₂ treatmentInhibition suggests presence of mercury-sensitive cysteine residues
Solute permeabilityUptake of radiolabeled glycerol/ureaDetermines if the AQP is an orthodox AQP or aquaglyceroporin

How does the structure of E. intestinalis AQP compare to other eukaryotic aquaporins?

Microsporidian aquaporins show distinct structural features compared to other eukaryotic AQPs:

  • Sequence homology: E. intestinalis AQP, like E. cuniculi AQP, likely exhibits limited sequence identity with human AQPs (approximately 24% identity with human AQP2 and 22% with AQP4) . This divergence suggests evolutionary adaptations specific to microsporidian biology.

  • NPA motifs: Microsporidian AQPs contain the conserved NPA (Asparagine-Proline-Alanine) motifs that line the aqueous pore, which is characteristic of the AQP family .

  • Mercury sensitivity determinants: Unlike human AQP1, which has a mercury-sensitive cysteine residue (C189) near the second NPA motif, microsporidian AQPs like EcAQP typically lack this cysteine, having a glycine (G203) instead. This explains their mercury insensitivity .

  • Phylogenetic positioning: Microsporidian AQPs don't cluster with either orthodox AQPs or aquaglyceroporins but instead branch with protist AQPs from organisms like Trypanosoma cruzi and Toxoplasma gondii, suggesting a unique evolutionary history .

What is the role of E. intestinalis AQP in spore germination and how might this inform therapeutic approaches?

The germination of microsporidian spores critically depends on rapid water influx, likely mediated by AQPs:

How can site-directed mutagenesis be used to study the function of E. intestinalis AQP?

Site-directed mutagenesis offers powerful insights into AQP structure-function relationships:

  • Mercury sensitivity engineering: By mutating glycine residues (like G203 in EcAQP) to cysteine near the NPA motifs, researchers could potentially create mercury-sensitive variants, confirming the structural basis for mercury insensitivity .

  • Selectivity filter modifications: Mutations in the aromatic/arginine (ar/R) constriction region, which determines solute selectivity, could reveal how E. intestinalis AQP achieves its selectivity for water over other solutes .

  • NPA motif alterations: Mutating the conserved NPA motifs can help understand their role in water conductance and proton exclusion in these specific microsporidian channels .

  • Experimental approach:

    • Generate mutants using PCR-based mutagenesis

    • Express wild-type and mutant proteins in Xenopus oocytes

    • Compare water permeability and other functional parameters

    • Correlate structural changes with functional differences

What transcriptomic changes occur in host cells upon infection with E. intestinalis, and how do they relate to AQP function?

Host cell transcriptional responses to E. intestinalis infection reveal important insights:

  • Host-pathogen interaction: Transcriptome analysis of infected human colonic Caco2 cells shows significant alterations in host cell signaling pathways during E. intestinalis infection .

  • Cellular structure effects: E. intestinalis infection induces nuclear, mitochondrial, and microvillar alterations in host enterocytes, potentially affecting water and nutrient transport mechanisms .

  • Aquaporin regulation: Although not explicitly stated in the search results, it's likely that host AQP expression is modulated during infection, potentially as part of the host defense or as a result of pathogen manipulation.

  • Research methodology: Combined approaches using transmission electron microscopy and RNA-seq analysis provide comprehensive insights into both structural changes and transcriptional responses during infection .

How do developmental studies of AQPs in model organisms inform our understanding of microsporidian AQPs?

Developmental studies of AQPs in model organisms provide valuable contextual insights:

  • Zebrafish aqp8 studies: Research on zebrafish aqp8ab shows it is crucial for proper intestinal development and lumen formation. When knocked out using CRISPR/Cas9, it leads to intestinal bifida and deformed intestines .

  • Relevance to microsporidia: While E. intestinalis AQP and zebrafish aqp8 are distinct proteins, understanding how AQPs function in intestinal development might inform how microsporidian AQPs interact with host intestinal cells, their primary site of infection .

  • Evolutionary insights: The distinct expression patterns of different aqp8 paralogs in zebrafish (aqp8aa in vascular system, aqp8ab in intestine, aqp8b in kidney) highlight how AQP functions have diversified across evolution, providing context for understanding specialized functions of microsporidian AQPs .

  • Methodological applications: The CRISPR/Cas9 knockout approach used in zebrafish could potentially be adapted to study AQP function in microsporidian laboratory models or host-pathogen interactions .

What innovative approaches could advance our understanding of E. intestinalis AQP function?

Several cutting-edge approaches could enhance microsporidian AQP research:

  • Cryo-electron microscopy: High-resolution structural studies of E. intestinalis AQP could reveal unique structural features that might be targeted for therapeutic development.

  • Live cell imaging techniques: Visualizing AQP dynamics during spore germination and host cell infection using fluorescently tagged AQPs could provide real-time insights into their functional roles.

  • Host-directed therapies: Exploring how modulation of host AQP expression affects susceptibility to microsporidian infection could yield novel therapeutic strategies that target host factors rather than the pathogen directly.

  • Comparative genomics: Broader comparative analysis of AQPs across microsporidian species that infect different hosts or tissues could reveal adaptations specific to intestinal infection by E. intestinalis.

What are the challenges in developing specific inhibitors of microsporidian AQPs?

Developing selective inhibitors faces several challenges:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.