Recombinant Enterobacter aerogenes Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Enterobacter aerogenes Lipoprotein Signal Peptidase (lspA)

Recombinant Enterobacter aerogenes Lipoprotein Signal Peptidase (lspA) is a bacterial enzyme critical for processing lipoproteins—proteins anchored to membranes via lipid modifications. lspA encodes type II signal peptidase (SPase II), which cleaves the signal peptide from prolipoproteins during their secretion. This enzyme is essential for the maturation of bacterial lipoproteins, many of which are virulence factors or involved in antibiotic resistance .

Table 1: Genomic and protein characteristics of E. aerogenes lspA

PropertyDetail
Genome locationLocus EAE_10850 in E. aerogenes KCTC 2190
Protein length165 amino acids (recombinant form)
Molecular functionType II signal peptidase (EC 3.4.23.36)
Conserved domainsFour transmembrane helices (TMHs), β-cradle, and catalytic residues
Amino acid sequence (1–165)MSKSICSTGLRWLWVVVAVLIIDLGSKFLILQNFALGETVSLFPSLNLHYARNYGAAFSF...

The enzyme’s structure includes a membrane-embedded domain and an extracellular β-cradle motif, which interacts with prolipoprotein substrates .

Functional Role in Lipoprotein Processing

SPase II catalyzes the cleavage of signal peptides after the conserved lipobox motif ([LVI][ASTVI][GAS]C) in prolipoproteins. This step is essential for:

  • Anchoring lipoproteins to bacterial membranes.

  • Activating virulence-associated lipoproteins in pathogens .
    In E. aerogenes, computational analysis of its genome predicts 89 secretory proteins, of which 14 are lipoproteins requiring SPase II for maturation .

Recombinant Expression and Applications

Recombinant E. aerogenes lspA is produced in Escherichia coli for research purposes. Key details include:

Table 2: Recombinant lspA production parameters

ParameterDetail
Expression hostEscherichia coli
TagDetermined during production (e.g., His-tag)
PurityOptimized via Tris-based buffer with 50% glycerol
Storage–20°C (long-term); 4°C for working aliquots

Functional assays using homologs (e.g., Rickettsia typhi lspA) demonstrate that SPase II activity can be inferred through:

  • Globomycin resistance: Overexpression confers resistance to this SPase II inhibitor .

  • Genetic complementation: Restores growth in temperature-sensitive E. coli mutants .

Key Studies on SPase II Homologs:

  1. Globomycin Resistance: Heterologous expression of R. typhi lspA in E. coli increased resistance to globomycin by >12.5 µg/ml, confirming functional activity .

  2. Transcriptional Regulation: In R. typhi, lspA expression peaks during active infection (48 hours post-invasion), correlating with lipoprotein secretion .

  3. Structural Insights: Crystal structures of Pseudomonas aeruginosa and Staphylococcus aureus LspA reveal conserved catalytic sites, supporting broad mechanistic similarities across species .

Table 3: Comparative activity of SPase II homologs

SpeciesFunctionKey Finding
Enterobacter aerogenesLipoprotein maturationRecombinant enzyme available for biochemical studies
Rickettsia typhiIntracellular pathogenicitySPase II critical for host cell invasion and survival
Escherichia coliModel system for SPase II studiesComplementation assays validate lspA functionality across species

Future Directions

Recombinant E. aerogenes lspA provides a tool for:

  • Developing SPase II inhibitors as novel antibiotics.

  • Studying lipoprotein-dependent mechanisms in Gram-negative pathogens.

  • Structural biology efforts to resolve enzyme-substrate interactions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
lspA; lsp; EAE_10850; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006) (Enterobacter aerogenes)
Target Names
lspA
Target Protein Sequence
MSKSICSTGLRWLWVVVAVLIIDLGSKFLILQNFALGETVSLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAVGICVVLAVLMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPSSDKKTS
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic organization of the lspA gene in Enterobacter aerogenes?

The lspA gene in Enterobacter aerogenes is organized within an operon structure similar to that found in Escherichia coli. Specifically, the gene is part of an operon consisting of ileS (encoding isoleucyl-tRNA synthetase), lspA, and three additional open reading frames designated as gene x, orf-149, and orf-316 . This genomic organization shows a high degree of conservation between E. coli and E. aerogenes, with the same five genes appearing in identical order in both organisms, suggesting the functional importance of this arrangement .

Nucleotide sequence analysis reveals significant homology between the E. aerogenes lspA gene and its E. coli counterpart, reflecting their evolutionary relationship within Enterobacteriaceae . This conservation extends beyond the coding sequence to the operon structure, suggesting similar regulatory mechanisms may control lspA expression in these related bacterial species.

How does recombinant E. aerogenes LspA compare to similar enzymes in other bacterial species?

The lipoprotein signal peptidase from E. aerogenes shares significant homology and functional characteristics with corresponding enzymes from other Gram-negative bacteria:

  • Sequence similarity: E. aerogenes LspA exhibits high sequence homology with the E. coli counterpart, reflecting their close evolutionary relationship within the Enterobacteriaceae family .

  • Operon structure: Both E. aerogenes and E. coli organize their lspA genes within identical five-gene operons (ileS-lspA-gene x-orf149-orf316), suggesting conservation of transcriptional regulation and possibly functional coupling with isoleucyl-tRNA synthetase .

  • Catalytic function: Like other bacterial LspA enzymes, E. aerogenes LspA functions in the second step of the lipoprotein processing pathway, following lipid modification by prolipoprotein diacylglyceryl transferase (Lgt) .

  • Membrane integration: LspA enzymes are typically integral membrane proteins with multiple transmembrane domains, a characteristic likely shared by the E. aerogenes enzyme.

Comparative analysis with LspA from other bacterial species, such as Staphylococcus aureus and Pseudomonas aeruginosa, for which high-resolution structures have been determined, could provide valuable insights into conserved catalytic mechanisms and species-specific features .

What are the optimal conditions for measuring E. aerogenes LspA enzyme activity?

The optimal conditions for measuring LspA activity must account for its nature as a membrane-embedded enzyme and the specific requirements for maintaining its functional state. Based on studies with related LspA enzymes, particularly from P. aeruginosa, the following conditions have proven effective:

  • Gel-shift assay conditions:

    • Buffer composition: 50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT

    • Detergent: 0.02% (w/v) LMNG (lauryl maltose neopentyl glycol)

    • Phospholipid supplement: 250 μM DOPG (dioleoylphosphatidylglycerol)

    • Temperature: 37°C

    • Reaction time: 30-60 minutes

    • Enzyme concentration: ~0.5 μM

  • FRET-based assay conditions:

    • Fluorescence monitoring: Ex/Em wavelengths of 320 nm/420 nm

    • Temperature: 37°C

    • Substrate concentration: ~80 μM

    • Enzyme concentration: 10-300 nM

Environmental factors significantly influence LspA activity in E. aerogenes, with research showing:

  • Optimal activity under low aeration and low agitation conditions

  • Significantly reduced activity under both fully aerobic and anaerobic conditions

  • Inhibition at high glucose concentrations (1%) through catabolic repression

  • Slight stimulation at low glucose concentrations (0.1%) compared to glucose-free media

The inclusion of appropriate controls is essential when measuring LspA activity, including substrate-only controls, heat-inactivated enzyme controls, and positive controls with well-characterized LspA enzymes from related species.

What experimental approaches can be used to study the structure-function relationship of E. aerogenes LspA?

Investigating the structure-function relationship of E. aerogenes LspA requires a multi-faceted approach combining structural biology, biochemistry, and molecular genetics techniques:

  • Structural determination methods:

    • X-ray crystallography: As demonstrated with S. aureus LspA, crystallography can reveal detailed structures of LspA in complex with inhibitors, providing insights into the catalytic mechanism

    • Cryo-electron microscopy: Particularly valuable for membrane proteins when crystallization proves challenging

    • NMR spectroscopy: For studying dynamic aspects of enzyme function and ligand interactions

  • Mutagenesis approaches:

    • Site-directed mutagenesis of predicted catalytic residues

    • Alanine-scanning mutagenesis to identify substrate binding determinants

    • Domain swapping experiments with LspA from other bacterial species

  • Enzyme kinetics analysis:

    • Determination of kinetic parameters using FRET-based substrates

    • Inhibition studies with known LspA inhibitors such as globomycin and myxovirescin

    • Investigation of structure-activity relationships through systematic substrate modifications

  • Membrane interaction studies:

    • Lipid composition effects on enzyme activity

    • Detergent screening for optimal solubilization while maintaining activity

    • Reconstitution into defined lipid environments

A comprehensive structure-function analysis would integrate these approaches to develop a detailed understanding of how E. aerogenes LspA recognizes and processes its substrates, potentially revealing species-specific features that could be exploited for selective inhibition.

How do environmental factors influence the expression and activity of E. aerogenes LspA?

Environmental factors significantly impact both the expression and enzymatic activity of LspA in E. aerogenes, with important implications for experimental design and interpretation:

  • Oxygen availability effects:

    • LspA activity is significantly reduced under both fully aerobic and anaerobic conditions

    • Optimal activity occurs under low aeration and low agitation conditions

    • Expression of heterologous oxygen uptake systems (Vitreoscilla hemoglobin) can reduce LspA activity by 10-fold to more than two orders of magnitude

  • Carbon source influence:

    • High glucose concentrations (1%) cause almost complete inhibition of LspA activity through catabolic repression mechanisms

    • Low glucose concentrations (0.1%) exert a slight stimulatory effect compared to glucose-free media

    • This suggests careful consideration of carbon sources in growth media for enzyme production

  • Temperature considerations:

    • As a membrane-embedded enzyme, LspA activity is likely influenced by temperature-dependent changes in membrane fluidity

    • Optimal temperature balances enzyme kinetics and membrane state

  • Growth phase dependence:

    • Expression levels and activity may vary depending on bacterial growth phase

    • Consideration of harvest timing is important for consistent enzyme preparation

These findings highlight the importance of carefully controlling environmental conditions when working with recombinant E. aerogenes LspA, particularly for comparative studies or when optimizing enzyme production for structural and functional investigations.

What are the challenges in developing selective inhibitors against E. aerogenes LspA?

Developing selective inhibitors against E. aerogenes LspA presents several technical and biological challenges:

  • Structural constraints:

    • The membrane-embedded nature of LspA complicates structural studies needed for rational inhibitor design

    • Limited availability of high-resolution structures specific to E. aerogenes LspA

    • Challenges in recreating the native membrane environment for functional assays

  • Selectivity considerations:

    • Conserved catalytic mechanism across bacterial LspA enzymes makes species-selective targeting difficult

    • Need for differential activity against pathogenic versus commensal bacteria

    • Requirement for selectivity against mammalian enzymes to minimize toxicity

  • Assay limitations:

    • Complex assay systems requiring lipid-detergent mixtures for maintaining enzyme activity

    • Challenges in developing high-throughput screening approaches for membrane enzymes

    • Potential disconnect between in vitro inhibition and in vivo efficacy

  • Resistance development concerns:

    • Potential for mutations in the lspA gene conferring resistance

    • Need for understanding the plasticity of the active site

    • Consideration of combination approaches targeting multiple steps in lipoprotein processing

Recent progress with related LspA enzymes provides promising directions, including:

  • The development of refined FRET-based assays suitable for inhibitor screening

  • High-resolution structural information from related enzymes complexed with inhibitors like globomycin and myxovirescin

  • Improved understanding of the catalytic mechanism that can inform inhibitor design

How can molecular serotyping techniques be applied to study E. aerogenes strains expressing different variants of LspA?

Molecular serotyping techniques offer powerful approaches for studying E. aerogenes strain diversity, including variations in the lspA gene that might influence pathogenicity or antimicrobial susceptibility:

  • Integration with polysaccharide gene cluster (PSgc) typing:

    • E. aerogenes exhibits diversity with 15 distinct PSgc types identified across strains from different geographical regions

    • Correlation analysis between lspA sequence variants and PSgc types could reveal functional relationships between lipoprotein processing and surface polysaccharide presentation

  • Multiplexed detection systems:

    • Luminex-based array methods developed for PSgc typing could be adapted to detect specific lspA variants

    • Double-blind validation testing could confirm the reliability of such systems, similar to approaches used for PSgc typing

  • Geographic and clinical distribution analysis:

    • Different regions show distinct predominant E. aerogenes serotypes (e.g., PSgc4 and PSgc7 dominant in Shanghai isolates; PSgc10 common in United States isolates)

    • Similar pattern analysis for lspA variants could reveal selection pressures in different environments

  • Structure-function implications:

    • Correlation of lspA sequence variations with differences in substrate specificity or inhibitor sensitivity

    • Potential effects on bacterial fitness, virulence, or antibiotic resistance

This integrated approach could provide important insights into how LspA variants might contribute to E. aerogenes diversity and pathogenicity, potentially revealing regional patterns that could inform surveillance and treatment strategies.

What assay systems are available for measuring E. aerogenes LspA activity?

Several complementary assay systems can be employed to measure E. aerogenes LspA activity, each offering distinct advantages for different research questions:

  • Gel-shift assays:

    • Principle: Detection of molecular weight changes in substrate proteins after signal peptide cleavage

    • Methodology:

      • Substrate preparation: Pre-prolipoprotein is converted to prolipoprotein using Lgt

      • Reaction conditions: 50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT, 0.02% LMNG

      • Typical concentrations: 12 μM substrate, 0.5 μM LspA, 250 μM DOPG

      • Visualization: SDS-PAGE followed by Coomassie staining or Western blotting

    • Advantages: Direct visualization of natural substrate processing

    • Limitations: Low throughput, semi-quantitative

  • FRET-based assays:

    • Principle: Cleavage of fluorogenic peptide substrates generates measurable fluorescence signal

    • Methodology:

      • Substrate design: Peptides containing FRET pairs that mimic LspA cleavage sites

      • Detection: Continuous fluorescence monitoring (Ex/Em: 320 nm/420 nm)

      • Typical reactions: 80 μM substrate, 10-300 nM enzyme at 37°C

    • Advantages: Continuous, quantitative, adaptable to high-throughput screening

    • Limitations: Uses synthetic rather than natural substrates

  • Inhibition assays:

    • Both gel-shift and FRET assays can be adapted to evaluate inhibitor potency

    • Inhibitor dose-response curves allow determination of IC50 values

    • Known inhibitors include globomycin and myxovirescin, which can serve as positive controls

  • In vivo complementation assays:

    • Based on functional complementation of lspA-deficient bacterial strains

    • Enables assessment of LspA function in a cellular context

    • Can be quantified through growth restoration or reporter gene expression

Assay TypeThroughputQuantitationSubstrate TypeKey Applications
Gel-shiftLowSemi-quantitativeNaturalMechanism studies, substrate specificity
FRET-basedHighQuantitativeSyntheticInhibitor screening, kinetic analysis
InhibitionMedium-HighQuantitativeBothDrug discovery, SAR studies
ComplementationLowQualitativeNaturalIn vivo relevance, mutant analysis

Selection of the appropriate assay system should be guided by the specific research question, required throughput, and whether natural substrate specificity is critical for the investigation.

How can recombinant E. aerogenes LspA be purified for structural studies?

Purification of recombinant E. aerogenes LspA for structural studies requires specialized approaches to maintain the integrity and activity of this membrane protein:

  • Expression optimization:

    • Vector selection: Plasmids with tunable promoters to control expression levels

    • Host strains: E. coli C41(DE3), C43(DE3), or Lemo21(DE3) designed for membrane proteins

    • Fusion tags: His6, Strep-tag, or MBP for purification and potential solubility enhancement

    • Culture conditions: Lower temperatures (16-20°C), controlled induction, consideration of aeration levels and glucose concentration based on findings that these factors significantly affect enzyme activity in E. aerogenes

  • Membrane extraction:

    • Cell disruption: Gentle methods such as French press or sonication

    • Membrane isolation: Differential centrifugation to separate membranes from cytosolic components

    • Detergent solubilization: Critical parameter for maintaining function

      • Effective detergents for related LspA enzymes include LMNG, DDM, and digitonin

      • Solubilization typically performed at 4°C for 1-2 hours with gentle agitation

      • Phospholipid addition (e.g., DOPG) often enhances stability and activity

  • Chromatographic purification:

    • Multi-step purification strategy:

      • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

      • Size exclusion chromatography to remove aggregates and ensure monodispersity

      • Optional ion exchange chromatography for further purification

    • Critical considerations:

      • Maintaining detergent concentration above critical micelle concentration

      • Addition of stabilizing agents (glycerol, specific lipids, ligands)

      • Temperature control throughout purification

  • Quality assessment:

    • Purity: SDS-PAGE, Western blotting with LspA-specific antibodies

    • Homogeneity: Dynamic light scattering, analytical size exclusion

    • Functional verification: Activity assays using FRET substrates or gel-shift assays

    • Thermal stability: Differential scanning fluorimetry or nanoDSF

  • Specialized approaches for structural studies:

    • For crystallography: Consideration of lipidic cubic phase crystallization

    • For cryo-EM: Reconstitution into nanodiscs or amphipols

    • For both: Screening of stabilizing ligands or inhibitors to lock specific conformations

The purification strategy should be iteratively optimized based on protein stability, yield, and functional activity assessments to identify conditions that maintain the native structure of E. aerogenes LspA.

What factors influence the expression of functional recombinant E. aerogenes LspA?

Multiple factors influence the successful expression of functional recombinant E. aerogenes LspA, requiring careful optimization:

  • Expression system selection:

    • Prokaryotic systems: E. coli remains the most common choice, with specialized strains like C41(DE3) and C43(DE3) designed for membrane proteins

    • E. aerogenes itself: Homologous expression may provide more native conditions but with potentially lower yields

    • Alternative systems: Cell-free expression systems allowing direct incorporation into defined lipid environments

  • Environmental factors with demonstrated effects on LspA activity:

    • Oxygen availability: Research shows dramatically different enzyme activity under varying aeration conditions:

      • Significantly reduced activity under both fully aerobic and anaerobic conditions

      • Optimal production under low aeration and low agitation

    • Carbon source effects:

      • High glucose (1%) causes almost complete inhibition through catabolic repression

      • Low glucose (0.1%) slightly stimulates activity compared to glucose-free media

  • Genetic and molecular considerations:

    • Codon optimization for the expression host

    • Signal sequence modifications to improve membrane targeting

    • Fusion partners that can enhance folding and stability

    • Induction strategy: Gradual induction often favors proper folding of membrane proteins

  • Purification process impacts:

    • Detergent selection critically influences retained activity

    • Lipid supplementation often necessary to maintain functional state

    • Buffer composition affects stability (pH, salt concentration, additives)

  • Functional verification approaches:

    • Activity assays using fluorogenic substrates

    • Thermal stability assessments

    • Binding studies with known inhibitors like globomycin or myxovirescin

The complex interplay between these factors necessitates systematic optimization for each specific application, with particular attention to the unique environmental sensitivities of E. aerogenes LspA regarding oxygen levels and carbon source concentration .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.