Recombinant Enterobacter aerogenes Maltose transport system permease protein malG (malG)

Shipped with Ice Packs
In Stock

Description

Definition and Recombinant Production

The malG protein is a hydrophobic, 296-amino-acid (aa) permease encoded by the malG gene in Enterobacter aerogenes. Recombinant malG is produced as a His-tagged fusion protein in E. coli, enabling purification via nickel affinity chromatography . Key properties include:

PropertyValue/Description
Molecular Weight~32 kDa (predicted from aa sequence)
Transmembrane SegmentsSix hydrophobic domains, anchoring the protein in the cytoplasmic membrane
Expression SystemE. coli (His-tagged, full-length 1–296 aa)
FormLyophilized powder (commercial recombinant product)

This recombinant form retains functional activity, validated through structural and biochemical studies.

Functional Roles

  1. Substrate Translocation:

    • Forms a heterodimer with MalF, creating a transmembrane pathway for maltose/maltodextrin entry .

    • Requires ATP hydrolysis by MalK for conformational changes that drive substrate import .

  2. MBP Interaction:

    • Binds MBP-loaded substrates via periplasmic domains, triggering ATPase activity in MalK .

    • MBP-independent mutants (e.g., malG insertions) reveal a secondary substrate-binding site in the transmembrane domain .

Key Mutagenesis Insights

Mutation TypeEffect on FunctionReference
Insertions in EAA MotifLoss of maltose transport; disrupts MBP interaction
Periplasmic Loop AlterationsRetains assembly with MalF/MalK but impairs substrate recognition
Cytoplasmic Loop MutationsPrevents MalK binding; destabilizes MalFGK₂ complex

Comparative Analysis

SpeciesSequence IdentityKey DifferencesReference
E. aerogenes vs. E. coli~90% for MalGRegulatory regions (e.g., U box) conserved across enterobacteria
E. aerogenes vs. SalmonellaHigh operon conservationIntergenic regions maintain PU/REP elements for stability

In Vitro Reconstitution

  • MalFGK₂ Complex: Purified MalF-MalG subunits reassemble with MalK in detergent solution or proteoliposomes, restoring ATPase activity and substrate transport .

  • MBP-Independent Transport: Mutants lacking MBP exhibit reduced affinity (Kₘ ~1 mM) but retain selectivity for α-1,4-linked oligosaccharides .

Substrate Specificity

  • Periplasmic Binding: MBP interacts with the reducing end of maltodextrins, while malG binds the nonreducing end via a transmembrane site .

  • Size Limitation: Transport restricted to linear chains ≤7 glucosyl units (maltoheptaose) .

Applications and Research Significance

  1. Structural Biology: Crystallographic studies of malG in E. coli (homolog) reveal conformational changes during substrate translocation .

  2. Therapeutic Targets: Mutations in malG disrupt pathogen metabolism, highlighting potential antimicrobial strategies .

  3. Biotechnology: Recombinant malG enables in vitro reconstitution of maltose transporters for mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your application.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
malG; Maltose/maltodextrin transport system permease protein MalG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Klebsiella aerogenes (Enterobacter aerogenes)
Target Names
malG
Target Protein Sequence
MAMVQPKSQKLRLFTTHLLLLIFIAAIMFPLLMVIAISLREGNFATGSLIPDTISWEHWR LALGFSVEHADGRVTPPPFPVLLWLWNSIKVAGITAIGIVALSTTCAYAFARMRFPGKAT LLKGMLIFQMFPAVLSLVALYALFDRLGQYLPFVGLNTHGGVIFAYMGGIALHVWTIKGY FETIDGSLEEAAALDGATPWQAFRLVLVPLSVPILAVVFILSFIAAITEVPVASLLLRDV NSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITVVFLLAQRWLVNGLTAGGVKG
Uniprot No.

Target Background

Function
Recombinant *Enterobacter aerogenes* Maltose transport system permease protein malG (malG) is a component of the ABC transporter complex MalEFGK involved in maltose/maltodextrin import. It is likely responsible for substrate translocation across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the maltose transport system in Enterobacter aerogenes and what role does MalG play?

The maltose transport system in Enterobacter aerogenes, similar to other Gram-negative bacteria, comprises a multicomponent complex that facilitates maltose and maltodextrin uptake across the bacterial membrane. MalG functions as one of the permease proteins within this system, forming part of the transmembrane channel that enables sugar transport. This protein works in conjunction with other components including MalF (another permease protein) and MalK (the ATP-binding cassette protein) to create a functional transport complex .

The system operates through substrate-binding proteins in the periplasm that capture maltose molecules and deliver them to the transmembrane complex, where MalG participates in creating the channel through which maltose passes into the cytoplasm. The entire process is energized by ATP hydrolysis mediated by MalK.

How does the structure of MalG relate to its function in maltose transport?

MalG in Enterobacter aerogenes is a hydrophobic integral membrane protein containing multiple transmembrane domains that span the cytoplasmic membrane. The protein's structural features include:

  • Approximately 6 transmembrane α-helical segments

  • Cytoplasmic loops that interact with the ATP-binding component (MalK)

  • Periplasmic loops that participate in substrate recognition

  • A conserved EAA motif (Glu-Ala-Ala) in the cytoplasmic loop, critical for interactions with MalK

These structural elements enable MalG to form part of the channel through which maltose passes and to participate in the conformational changes that occur during the transport cycle. The transmembrane domains create the pore while the cytoplasmic domains couple ATP hydrolysis to substrate transport through interactions with MalK .

What expression systems are commonly used for recombinant production of E. aerogenes MalG?

Several expression systems have been employed for the recombinant production of membrane proteins like MalG from Enterobacter aerogenes, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical Yield (mg/L culture)
E. coli BL21(DE3)High expression levels, genetic similarity to E. aerogenesPotential toxicity, inclusion body formation0.5-3
E. coli C43(DE3)Specialized for membrane proteins, reduced toxicityLower expression compared to BL210.3-2
Cell-free systemsAvoids toxicity issues, direct access to reaction conditionsHigher cost, limited post-translational modifications0.1-0.8
Yeast (P. pastoris)Eukaryotic folding machinery, scalableGlycosylation may differ, longer production time0.2-1.5

Most researchers opt for E. coli expression systems due to the genetic similarity between E. coli and E. aerogenes, which facilitates proper folding and insertion of MalG into the membrane. Expression typically employs pET or pBAD vector systems with inducible promoters to control protein production .

What are the optimal conditions for purifying recombinant E. aerogenes MalG while maintaining its native conformation?

Purification of MalG requires careful optimization to maintain the protein's native structure and function. The recommended protocol involves:

  • Membrane extraction: Isolate bacterial membranes through differential centrifugation after cell disruption by sonication or French press.

  • Detergent solubilization: Solubilize membranes using mild detergents; n-dodecyl-β-D-maltoside (DDM) at 1-2% w/v is often preferred due to its ability to maintain protein stability.

  • Affinity chromatography: Utilize His-tagged MalG for IMAC purification with optimized imidazole gradient (20-250 mM) to reduce non-specific binding.

  • Size exclusion chromatography: Further purify protein through gel filtration to separate monomeric MalG from aggregates and other contaminants.

  • Detergent exchange: If necessary, exchange the initial detergent for one more suitable for downstream applications.

Critical parameters include maintaining the pH between 7.0-8.0, adding glycerol (10-20%) as a stabilizer, and including protease inhibitors throughout the purification process. Temperature control is essential, with all steps preferably performed at 4°C to minimize protein degradation .

How can researchers effectively verify the functional integrity of purified recombinant MalG protein?

Verifying the functional integrity of purified MalG requires multiple complementary approaches:

  • Substrate binding assays: Measure the binding affinity of radiolabeled maltose or fluorescently-labeled maltodextrins to reconstituted MalG-containing complexes.

  • Proteoliposome reconstitution and transport assays: Incorporate purified MalG along with other maltose transport system components (MalF, MalK) into liposomes and measure maltose uptake rates.

  • ATPase activity coupling: Assess whether the reconstituted complex shows maltose-stimulated ATPase activity, indicating proper coupling between substrate binding and ATP hydrolysis.

  • Thermostability assays: Employ differential scanning fluorimetry to evaluate protein stability in various buffer conditions, with functional protein showing characteristic melting curves.

  • Cross-linking studies: Use chemical cross-linkers to verify interactions between MalG and other components of the transport system (MalF, MalK).

A fully functional MalG should demonstrate specific maltose-dependent responses in these assays, with transport rates comparable to those observed in native membrane vesicles (typically 1-5 nmol/min/mg protein) .

What are the recommended methods for studying the interaction between MalG and other components of the maltose transport system?

Several complementary methods are recommended for investigating the interactions between MalG and other components of the maltose transport system:

  • Co-immunoprecipitation (Co-IP): Use antibodies against MalG or epitope tags to pull down interacting partners, followed by Western blot analysis or mass spectrometry identification.

  • Bacterial two-hybrid (BTH) systems: Particularly useful for membrane proteins, BTH can detect interactions between MalG and other components in vivo.

  • Surface plasmon resonance (SPR): Quantitatively measure binding kinetics and affinities between purified MalG and other purified components immobilized on sensor chips.

  • Cross-linking coupled with mass spectrometry: Identify specific interaction sites between MalG and other proteins through chemical cross-linking followed by proteolytic digestion and mass spectrometric analysis.

  • Fluorescence resonance energy transfer (FRET): Tag MalG and potential partners with appropriate fluorophores to detect proximity-based energy transfer in reconstituted systems or intact cells.

  • Cryo-electron microscopy: Visualize the complete transport complex structure, providing insights into how MalG interfaces with other components.

Each method provides unique insights, with FRET and cross-linking offering dynamic information, while structural approaches provide static snapshots of the interactions .

How can the MalG permease be engineered to alter substrate specificity in E. aerogenes?

Engineering MalG to modify its substrate specificity involves targeted approaches based on structural and functional knowledge:

  • Site-directed mutagenesis: Identify and modify specific residues in the substrate-binding pocket based on sequence alignments with related transporters having different specificities. Key residues typically include aromatic and charged amino acids that form hydrogen bonds or hydrophobic interactions with substrates.

  • Domain swapping: Replace entire domains or loops of MalG with corresponding regions from transporters with desired specificity profiles.

  • Directed evolution: Apply random mutagenesis to MalG followed by selection systems designed to identify variants with altered substrate preferences.

Research has shown that mutations in the transmembrane helices TM4 and TM5 of MalG can significantly affect substrate specificity. For example, substitutions of residues forming the central cavity can change preference from maltose to larger maltodextrins or even structurally dissimilar sugars.

The effectiveness of these approaches can be quantified through transport assays using various potential substrates:

SubstrateWild-type MalG Km (μM)Engineered MalG Example Km (μM)Fold Change
Maltose1-510-50↓ 5-10x
Maltotriose5-150.5-2↑ 7-10x
Lactose>100050-200↑ 5-20x
CyclodextrinNot transported100-500Novel transport

Successful engineering requires detailed structural knowledge and often multiple rounds of optimization .

What approaches can be used to study the dynamics of MalG during the maltose transport cycle?

Studying the conformational dynamics of MalG during transport requires sophisticated techniques that capture transient states:

  • Single-molecule FRET (smFRET): Label specific residues in MalG with donor and acceptor fluorophores to track distance changes during the transport cycle in real-time.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identify regions of MalG that undergo conformational changes by measuring differences in hydrogen-deuterium exchange rates in different transport states.

  • Electron paramagnetic resonance (EPR) spectroscopy: Introduce spin labels at strategic positions to monitor local environmental changes and distances between specific sites during substrate transport.

  • Molecular dynamics simulations: Complement experimental approaches with computational models that predict conformational changes in response to substrate binding and ATP hydrolysis.

  • Time-resolved crystallography or cryo-EM: Capture structural snapshots of the transport complex in different states by rapidly freezing samples at defined time points after initiation of transport.

These methods have revealed that MalG undergoes substantial conformational changes, with the periplasmic gate opening to receive substrate, followed by closure and opening of the cytoplasmic gate to release substrate into the cell. The complete cycle typically occurs on a millisecond to second timescale, with specific transition rates dependent on substrate concentration and ATP availability .

How does antibiotic resistance in E. aerogenes affect the function and expression of the maltose transport system?

The relationship between antibiotic resistance and maltose transport in Enterobacter aerogenes is complex and multifaceted:

  • Membrane permeability alterations: E. aerogenes develops resistance to antibiotics like imipenem through porin loss, which can simultaneously affect expression and function of other membrane proteins including MalG. Studies have shown that imipenem-resistant strains often display altered maltose utilization profiles due to these membrane changes .

  • Regulatory cross-talk: The mar operon, which contributes to multidrug resistance in E. aerogenes, can influence expression of various transporters including the mal operon. MarA overexpression has been shown to decrease porin expression while potentially affecting other membrane proteins through altered gene regulation .

  • Energy allocation trade-offs: Antibiotic efflux pumps require significant cellular energy, potentially competing with ATP-dependent transporters like the maltose system for the available energy pool.

  • Adaptive responses: Long-term antibiotic exposure can lead to global changes in membrane composition and organization that indirectly impact maltose transport efficiency.

Research has demonstrated that colistin-resistant strains of E. aerogenes show approximately 30-50% reduction in maltose uptake rates compared to susceptible strains, correlating with altered membrane lipid composition and reduced MalG expression levels. This relationship between resistance mechanisms and nutrient acquisition capabilities represents an important area for understanding bacterial fitness in clinical environments .

What are common challenges in expressing recombinant MalG in heterologous systems and how can they be overcome?

Researchers frequently encounter several challenges when expressing MalG in heterologous systems:

  • Toxicity to host cells:

    • Problem: Overexpression of membrane proteins often causes growth inhibition or cell death.

    • Solution: Use tightly regulated promoters (like pBAD), lower induction temperatures (16-25°C), and specialized host strains like C41/C43(DE3) designed for toxic membrane proteins.

  • Incorrect membrane insertion:

    • Problem: MalG may not properly integrate into the membrane.

    • Solution: Co-express with chaperones (GroEL/GroES, DnaK/J), optimize signal sequences, and include fusion partners that enhance membrane targeting.

  • Protein aggregation:

    • Problem: Formation of inclusion bodies containing misfolded protein.

    • Solution: Reduce expression rate through lower inducer concentrations, express as fusion with solubility-enhancing tags (MBP, SUMO), and optimize growth media composition.

  • Low expression levels:

    • Problem: Insufficient protein production for downstream applications.

    • Solution: Codon optimization for the host organism, use of strong ribosome binding sites, and screening multiple constructs with varying N- and C-terminal regions.

  • Proteolytic degradation:

    • Problem: Rapid degradation of expressed protein.

    • Solution: Include protease inhibitors, use protease-deficient strains, and optimize cell disruption methods to minimize exposure to proteases.

Success rates can be improved by systematically testing multiple expression conditions in parallel and using GFP fusion constructs to rapidly screen for properly folded and membrane-inserted protein .

What quality control measures should be implemented when working with purified recombinant MalG?

A comprehensive quality control pipeline for purified recombinant MalG should include:

  • Purity assessment:

    • SDS-PAGE analysis: ≥95% purity ideal for functional studies

    • Western blotting using anti-MalG or anti-tag antibodies

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

  • Structural integrity evaluation:

    • Circular dichroism (CD) spectroscopy to verify secondary structure content

    • Analytical size exclusion chromatography to assess monodispersity

    • Dynamic light scattering to detect aggregation

  • Functional verification:

    • Substrate binding assays using tryptophan fluorescence quenching or isothermal titration calorimetry

    • ATPase activity measurements when reconstituted with MalK

    • Transport activity in proteoliposomes

  • Stability monitoring:

    • Thermal stability using differential scanning fluorimetry

    • Time-course activity assays at storage temperature

    • Freeze-thaw stability testing if freezing is part of the storage protocol

  • Detergent evaluation:

    • Detergent concentration verification using colorimetric assays

    • Detergent exchange efficiency validation

    • Lipid content analysis if native lipids are co-purified

A standardized checklist approach ensures consistency between protein preparations, with acceptable parameters established empirically for each specific application. For structural studies, more stringent criteria are typically required compared to functional screening applications .

How can researchers troubleshoot inconsistent results in MalG functional assays?

When encountering inconsistent results in MalG functional assays, researchers should systematically investigate several potential sources of variability:

  • Protein quality issues:

    • Verify batch-to-batch consistency using activity assays with standard substrates

    • Check for degradation using anti-MalG Western blots

    • Assess aggregation state using analytical size exclusion chromatography

    • Determine if freeze-thaw cycles are affecting activity

  • Assay component variables:

    • Use consistent detergent:protein ratios across experiments

    • Prepare fresh nucleotides (ATP) and verify purity using HPLC

    • Control for subtle pH differences (±0.1 units can affect activity)

    • Standardize lipid composition for reconstitution experiments

  • Environmental factors:

    • Monitor temperature fluctuations during assays

    • Control for light exposure when using fluorescent probes

    • Eliminate metal contamination through EDTA treatment or high-purity reagents

    • Account for oxygen levels in anaerobic assays

  • Technical execution:

    • Implement rigorous pipetting protocols with calibrated equipment

    • Use internal standards to normalize between experimental runs

    • Perform time-course measurements rather than single endpoints

    • Evaluate operator-to-operator variation through standardized training

  • Data analysis approach:

    • Apply consistent background correction methods

    • Use appropriate curve-fitting models for kinetic data

    • Implement statistical tests to identify outliers

    • Analyze raw data rather than derived parameters when possible

A systematic troubleshooting approach often reveals that inconsistencies stem from multiple small variables rather than a single major factor. Maintaining detailed laboratory notebooks with explicit recording of seemingly minor procedural details can be invaluable for identifying sources of variability .

How might high-throughput approaches advance our understanding of MalG structure-function relationships?

High-throughput approaches offer transformative potential for elucidating MalG structure-function relationships:

  • Deep mutational scanning: Creating comprehensive libraries of single or multiple mutations throughout MalG can map the functional importance of each residue. Such approaches have already identified critical residues in the substrate-binding pocket and at interfaces with other transport system components.

  • Microfluidic-based functional assays: Encapsulating individual bacteria expressing MalG variants in droplets containing fluorescent maltose analogs allows rapid screening of thousands of variants for transport activity differences.

  • Cryo-EM conformational ensemble analysis: Advances in cryo-EM now enable identification of multiple conformational states from a single sample, potentially capturing the complete conformational landscape of MalG during transport.

  • Computational modeling and simulation: Machine learning approaches combined with molecular dynamics simulations can predict how mutations affect structure and function, guiding experimental efforts.

  • Synthetic biology sensor systems: Engineering bacteria with fluorescent reporters coupled to maltose transport provides high-throughput screening platforms for MalG variants or conditions affecting transport.

These approaches have begun to yield comprehensive datasets that reveal patterns not apparent from traditional low-throughput experiments. For example, recent deep mutational scanning of ABC transporters has identified clusters of residues that move together during conformational changes, suggesting coordinated functional domains within the protein structure .

What potential applications exist for engineered MalG proteins in biotechnology and medical research?

Engineered MalG proteins offer diverse applications in biotechnology and medicine:

  • Biosensor development: Modified MalG proteins with altered substrate specificity or coupled to detection systems can serve as selective sensors for various sugars, environmental contaminants, or biomarkers in diagnostic platforms.

  • Drug delivery systems: MalG-based transporters incorporated into liposomes could enable controlled uptake and release of therapeutic compounds, particularly sugar-conjugated drugs.

  • Metabolic engineering: Modified maltose transporters could enhance sugar uptake in industrial microorganisms, improving production of biofuels, chemicals, and pharmaceuticals from renewable feedstocks.

  • Antibiotic development: Understanding MalG structure and function in detail provides targets for developing novel antibiotics that inhibit essential sugar transport in pathogenic bacteria.

  • Protein production platforms: The maltose transport system can be leveraged for improved production of difficult-to-express proteins through specialized fusion systems.

Research progress in these areas is reflected in recent achievements, such as:

ApplicationCurrent Development StageKey ChallengesPotential Impact
BiosensorsProof-of-concept demonstrationsSensitivity, specificity, stabilityPoint-of-care diagnostics
Drug deliveryEarly research stageIn vivo stability, targetingTargeted therapies with reduced side effects
Metabolic engineeringLaboratory-scale demonstrationsBalancing transport with metabolismEnhanced industrial bioproduction
Antibiotic developmentTarget identificationSpecificity, deliveryNovel antimicrobials for resistant infections

The translation of fundamental MalG research into these applications represents an important bridge between basic science and practical biotechnology .

How does the study of E. aerogenes MalG contribute to our broader understanding of membrane transport systems?

Research on E. aerogenes MalG offers several significant contributions to the broader field of membrane transport:

  • Evolutionary insights: Comparative studies between E. aerogenes MalG and homologous proteins in other species reveal evolutionary patterns in transport system development and specialization. These analyses have identified both highly conserved regions critical for fundamental transport mechanisms and variable regions associated with species-specific adaptations.

  • Mechanistic principles: Detailed functional characterization of MalG provides insights into general mechanisms of ABC transporters, one of the largest protein families. Recent studies have revealed that the conformational changes in MalG during transport follow principles applicable to many other ABC transporters, suggesting common evolutionary origins and mechanistic constraints.

  • Membrane protein biophysics: Research on MalG has contributed to our understanding of how membrane proteins fold, insert into lipid bilayers, and maintain stability. These findings inform broader questions about membrane protein biophysics relevant across diverse biological systems.

  • Bacterial physiology: Understanding maltose transport in E. aerogenes contextualizes how pathogenic bacteria adapt their metabolism in host environments, particularly in resource-limited conditions found during infection. This knowledge connects to broader themes in bacterial physiology and host-pathogen interactions.

  • Transporter regulation: Studies on how MalG expression and function are regulated provide models for understanding integration of transport systems with cellular metabolism and environmental responses.

The study of E. aerogenes MalG thus serves as both a specific case study and a model system that generates principles applicable across membrane biology, from basic science to medical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.