Recombinant Enterobacter aerogenes Methyl-accepting chemotaxis aspartate transducer (tas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tas; EAE_15540; Methyl-accepting chemotaxis aspartate transducer
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-536
Protein Length
full length protein
Species
Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006) (Enterobacter aerogenes)
Target Names
tas
Target Protein Sequence
MFNRIRISTSLFLLLISFCIMQLISTGLSYVALRADNHNLERITVSSQQRDALSLSWVSL LQARNTLNRAGTRAALKVPQEQVDALMGGARSSLQKADLYFNQFLDTPRADEQEQQLADA TRDSYENLRGALRELIVFLENRNLQAFMDQPTQKIQDRFEADFVQYLQLAKATTDEASAS SQQAYGWSIWLVAGAVLMLLVVTLSAMWWLRTMLVQPLNIIRGHFERIASGDLSAPIEVY GRNEISQLFASLQRMQQSLIGTVGAVRDGAESILIGLQEIAEGNNDLSSRTEQQAASLEE TAASMEQLTATVKQNADNARQASQLARDASSTAAKGGELADDVVTTMHDIANSSQKIGAI TSVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKLLIDES VSRVKHGSVLVENSGATMQDIVRSVTRVTDIMGEIASASDEQSRGIEQVTQAVTQMDQVT QQNAALVVESASAAAALEEQAITLADAVAVFRLADDNFVAPETSSTVKETLDCQTA
Uniprot No.

Target Background

Function

This recombinant Enterobacter aerogenes methyl-accepting chemotaxis aspartate transducer (Tas) protein responds to environmental aspartate concentration changes. It transduces extracellular signals intracellularly, mediating sensory adaptation through methylation level variations. Chemotactic-signal transducers similarly respond to attractant and repellent concentration changes, transducing signals and enabling sensory adaptation via methylation levels. Attractants increase methylation (via CheR methyltransferase), while repellents decrease methylation (via CheB methylesterase).

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What methodologies are most effective for cloning and expressing recombinant E. aerogenes tas in heterologous systems?

For successful cloning and expression of recombinant E. aerogenes tas, researchers should consider a complementation approach in E. coli chemotaxis mutants. Based on established protocols, the following methodology is recommended:

  • PCR amplification of the target gene from E. aerogenes genomic DNA using primers designed from the conserved regions

  • Cloning into expression vectors with appropriate promoters compatible with enteric bacteria

  • Transformation into E. coli strains deficient in aspartate chemotaxis (tar mutants)

  • Functional validation through chemotaxis assays

The complementation test is particularly valuable as it confirms not only expression but also functional activity of the recombinant protein. Researchers should note that the E. aerogenes tas gene can complement aspartate taxis but not maltose taxis in E. coli tar mutants, which serves as an important control for specificity .

How can researchers effectively design chemotaxis assays to evaluate the functionality of recombinant tas proteins?

Effective chemotaxis assays for evaluating tas functionality should include:

Assay ComponentRecommended Approach
Cell preparationUse logarithmic phase cultures in motility buffer
Gradient establishmentCreate defined aspartate gradients using µ-Slide Chemotaxis chambers
Imaging parametersTime-lapse microscopy with 10-minute intervals over 24 hours
ControlsInclude negative (-/-) and positive (attractant/attractant) controls
Data collectionTrack at least 40 individual cells per condition
AnalysisMeasure directional persistence, velocity, and chemotactic index

It's critical to include appropriate controls: negative controls without attractant and positive controls with uniform attractant concentration. Biological replicates (minimum three) are essential for statistical validity. For image acquisition, phase contrast microscopy with proper calibration (e.g., 0.805 μm/pixel) provides optimal tracking resolution .

What evolutionary insights can be derived from comparing the tas gene sequences across different Enterobacteriaceae species?

Comparative analysis of tas gene sequences reveals several key evolutionary insights:

These patterns suggest that while the basic signaling mechanism is preserved across species, ligand specificity and regulatory mechanisms have evolved to adapt to specific ecological niches.

How do the conserved binding regions in tas compare with other chemotaxis receptors that don't bind amino acids?

The periplasmic domains of Tas and other amino acid-binding chemotaxis receptors (Tsr, Tar, Tse) contain several short conserved sequences that are absent in non-amino acid binding receptors like Tap and Trg. These conserved regions include specific residues directly implicated in amino acid binding.

Detailed sequence analysis shows:

  • Several short motifs are specifically conserved among amino acid-binding receptors

  • These motifs form three-dimensional binding pockets with precise spatial arrangements

  • Key residues within these motifs make direct contact with the amino acid ligand

  • The binding pocket architecture differs between aspartate-binding (Tas/Tar) and serine-binding (Tse/Tsr) receptors

This pattern suggests convergent or divergent evolution of binding specificity while maintaining the core signal transduction mechanism. Researchers investigating binding sites should focus on these conserved regions when designing mutagenesis experiments to alter ligand specificity .

What role might chemotaxis transducers play in the pathogenicity and antibiotic resistance of E. aerogenes?

While direct evidence linking tas to antibiotic resistance is limited, several potential mechanisms connect chemotaxis to pathogenicity and resistance:

  • Biofilm formation: Chemotaxis systems guide bacteria toward favorable environments, potentially facilitating attachment to surfaces and subsequent biofilm formation. Biofilms significantly increase antibiotic resistance by creating physical barriers to antibiotic penetration.

  • Virulence regulation: Chemotaxis systems may regulate the expression of virulence factors in response to environmental cues, potentially coordinating with resistance mechanisms.

  • Co-regulation with efflux systems: The search results indicate multiple efflux transporters in E. aerogenes that contribute to antibiotic resistance, particularly the AcrA-AcrB-TolC system. These systems may be co-regulated with chemotaxis genes under certain environmental conditions .

  • Plasmid transfer: E. aerogenes has demonstrated the ability to transfer resistance plasmids to other bacterial species in vivo. Chemotaxis may influence cell-to-cell contact rates, potentially affecting horizontal gene transfer frequencies .

Research investigating these connections should employ genetic approaches such as creating tas knockout mutants and evaluating changes in biofilm formation, antibiotic susceptibility, and virulence gene expression.

How has the genomic context of the tas gene evolved in multidrug-resistant strains of E. aerogenes?

Genomic analysis of multidrug-resistant E. aerogenes strains reveals important insights about the evolution of the tas gene and its genomic context:

In the sequenced genomes of multidrug-resistant E. aerogenes isolates, the chemotaxis genes are organized differently compared to antibiotic-sensitive strains. The genomic region containing the tas gene is part of a 5-kilobase segment that includes:

  • A 3' fragment of the cheA gene

  • Complete cheW gene

  • tse gene (taxis to serine)

  • tas gene

  • A 5' fragment of the cheR gene

This organization places tas in a functional chemotaxis operon, suggesting coordinated expression of multiple chemotaxis components. While multidrug resistance in E. aerogenes is primarily associated with beta-lactamase production, efflux pump overexpression, and porin loss, the potential regulatory connections between chemotaxis and resistance mechanisms require further investigation .

Researchers examining genomic data from clinical isolates should analyze whether specific mutations or regulatory changes in the tas gene or its flanking regions correlate with resistance profiles.

What are the optimal approaches for expressing and purifying the periplasmic domain of tas for structural studies?

For structural studies of the tas periplasmic domain, researchers should consider the following optimized protocol:

  • Construct design:

    • Express only the periplasmic domain (approximately residues 25-190)

    • Include a cleavable N-terminal His-tag for purification

    • Remove any potential aggregation-prone regions

  • Expression system:

    • Use E. coli BL21(DE3) with pET vector system

    • Culture in minimal media supplemented with isotopes for NMR studies

    • Induce at low temperature (16-18°C) for enhanced folding

  • Purification strategy:

    • Initial IMAC (immobilized metal affinity chromatography)

    • Tag cleavage with TEV protease

    • Secondary ion-exchange chromatography

    • Final size-exclusion chromatography in buffer optimized for structural studies

  • Quality assessment:

    • Circular dichroism to confirm secondary structure

    • Dynamic light scattering to verify monodispersity

    • Ligand binding assays to confirm functionality

This approach has proven successful for related periplasmic domains from other methyl-accepting chemotaxis proteins and should yield protein suitable for crystallography or NMR studies .

What advanced analytical techniques can distinguish the specific binding characteristics of tas from other chemotaxis receptors?

To differentiate the binding characteristics of tas from other chemotaxis receptors, researchers should employ complementary advanced analytical techniques:

  • Isothermal Titration Calorimetry (ITC):

    • Provides direct measurement of binding thermodynamics

    • Can determine binding affinity (Kd), stoichiometry, enthalpy, and entropy

    • Enables comparison of binding energetics between different receptors

  • Surface Plasmon Resonance (SPR):

    • Allows real-time monitoring of binding kinetics

    • Determines association (kon) and dissociation (koff) rate constants

    • Can detect subtle differences in binding mechanisms

  • Fluorescence-based assays:

    • Intrinsic tryptophan fluorescence to monitor conformational changes

    • Fluorescently labeled ligands to track binding directly

    • FRET-based approaches to measure distances between domains

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps regions of protein that change solvent accessibility upon ligand binding

    • Identifies conformational changes specific to tas compared to other receptors

    • Detects allosteric effects of binding

  • Computational modeling:

    • Molecular dynamics simulations of receptor-ligand complexes

    • Identification of binding residues through in silico mutagenesis

    • Comparative analysis of binding pocket electrostatics across receptor types

These techniques, when used in combination, provide a comprehensive characterization of binding specificity that can explain the functional differences between tas and other chemotaxis receptors .

What are the key considerations when designing CRISPR-Cas9 systems for targeted modification of the tas gene in E. aerogenes?

When designing CRISPR-Cas9 systems for targeted modification of the tas gene in E. aerogenes, researchers should consider:

  • Guide RNA design:

    • Select target sites with minimal off-target effects using algorithms specific for bacterial genomes

    • Avoid regions with secondary structure that might interfere with Cas9 binding

    • Target conserved functional domains for knockout studies or non-critical regions for tagging

  • Delivery method:

    • Use temperature-sensitive plasmids for transient expression

    • Consider electroporation protocols optimized for Enterobacteriaceae

    • Design donor templates with sufficient homology arms (>500 bp) for efficient homologous recombination

  • Selection strategy:

    • Implement scarless modification techniques to avoid polar effects on downstream genes in the operon

    • Use CRISPR-based counterselection rather than antibiotic markers when possible

    • Consider the operonic structure (with tse gene) when designing modifications

  • Validation approaches:

    • Sequence the entire operon to confirm specificity

    • Perform RT-qPCR to assess effects on operon expression

    • Conduct phenotypic assays for chemotaxis function

  • Potential challenges:

    • The resistance profile of clinical isolates may complicate selection strategies

    • The operonic organization with tse requires careful design to avoid polar effects

    • Efficient transformation protocols may need optimization for clinical isolates

These considerations are particularly important given the genomic context of tas, which is in an operon with tse and flanked by other chemotaxis genes (cheA, cheW, cheR) .

How can researchers develop an inducible expression system for controlled studies of tas function in E. aerogenes?

For developing an inducible expression system for controlled studies of tas function in E. aerogenes, researchers should consider this comprehensive approach:

  • Promoter selection:

    • The tetracycline-responsive system (Tet-On/Tet-Off) offers tight control with minimal basal expression

    • The arabinose-inducible system (PBAD) provides dose-dependent expression levels

    • The rhamnose-inducible system shows low background in Enterobacteriaceae

  • Vector design:

    • Include transcriptional terminators upstream of the inducible promoter

    • Incorporate a ribosome binding site optimized for E. aerogenes

    • Design compatible with the operonic structure (consider whether to express tas alone or the entire tse-tas operon)

  • Expression verification:

    • Western blotting with domain-specific antibodies

    • RT-qPCR to quantify transcript levels

    • Fluorescent protein fusions for localization studies

  • Functional assessment:

    • Chemotaxis assays at varying inducer concentrations

    • Complementation studies in chemotaxis-deficient strains

    • Protein-protein interaction studies to assess integration with chemotaxis machinery

  • Optimization parameters:

    • Inducer concentration range determination

    • Induction timing relative to growth phase

    • Expression level impact on cell physiology

This methodological approach enables precise control of tas expression levels, facilitating studies of dose-dependent effects on chemotaxis, potential cross-talk with resistance mechanisms, and integration with the chemotaxis signal transduction pathway .

What experimental designs can effectively correlate tas expression levels with chemotactic response intensity?

To effectively correlate tas expression levels with chemotactic response intensity, researchers should implement a multi-parameter experimental design:

  • Expression level control and quantification:

    • Establish an inducible expression system with graded inducer concentrations

    • Quantify tas protein levels via Western blotting with calibrated standards

    • Validate mRNA levels using RT-qPCR with appropriate reference genes

  • Chemotaxis assay platform:

    • Implement μ-Slide Chemotaxis chambers with defined gradients

    • Use time-lapse microscopy with 10-minute intervals over 24 hours

    • Track at least 40 individual cells per condition

  • Data collection parameters:

    • Cell velocity (μm/min)

    • Directional persistence (ratio of displacement to total distance)

    • Chemotactic index (projection of movement in gradient direction)

    • Turn frequency and angular distribution

  • Experimental matrix:

    • Multiple tas expression levels (at least 5 different inducer concentrations)

    • Various aspartate gradient strengths (at least 3 different concentrations)

    • Control conditions (no gradient, non-functional tas mutant)

  • Data analysis approach:

    • Derive dose-response curves relating expression level to chemotactic parameters

    • Apply mathematical modeling to extract sensitivity and adaptation parameters

    • Calculate Hill coefficients to determine cooperativity in the response

This comprehensive approach enables researchers to establish quantitative relationships between tas expression and chemotactic efficiency, revealing potential threshold effects, saturation points, and response dynamics .

How does the methylation state of tas affect its signaling properties and adaptation kinetics?

The methylation state of tas significantly impacts its signaling properties and adaptation kinetics through multiple mechanisms:

  • Adaptation mechanism:

    • Methylation of specific glutamate residues in the cytoplasmic domain modulates receptor signaling activity

    • Addition of methyl groups by CheR methyltransferase increases receptor activity

    • Removal of methyl groups by CheB methylesterase decreases receptor activity

    • This dynamic methylation/demethylation enables temporal sensing and adaptation to stable gradients

  • Methylation sites:

    • The cytoplasmic domain contains conserved methylation sites (typically 4-5 per receptor)

    • These sites are located in alpha-helical regions forming a coiled-coil structure

    • The methylation sites in tas show high sequence similarity to those in E. coli Tar

  • Experimental approaches to study methylation effects:

    • Site-directed mutagenesis to create methylation-mimicking variants (Glu→Gln)

    • Mass spectrometry to directly quantify methylation levels

    • In vitro reconstitution with purified CheR and CheB enzymes

    • Immunoblotting with methylation-specific antibodies

  • Adaptation kinetics parameters:

    • Adaptation time (time to return to baseline after stimulus)

    • Precision of adaptation (degree to which baseline activity is restored)

    • Dynamic range (range of concentrations over which adaptation occurs)

    • Memory (effect of previous stimuli on current adaptation state)

The E. aerogenes tas protein is likely regulated by a similar methylation-based adaptation system as found in other enteric bacteria, particularly since the genomic context of tas includes a fragment of the cheR gene, which encodes the methyltransferase responsible for receptor methylation .

How can researchers engineer the tas receptor for novel sensing applications or synthetic biology circuits?

Engineering the tas receptor for novel sensing applications involves systematic modification of key domains while preserving signaling functionality:

  • Receptor domain engineering strategies:

    • Periplasmic domain swapping with other sensing proteins to create hybrid receptors

    • Directed evolution to generate receptors with novel ligand specificity

    • Rational design based on structural information to modify binding pocket residues

    • Fusion with artificial binding domains like nanobodies or aptamer-binding proteins

  • Signal transduction modifications:

    • Alteration of methylation sites to control adaptation kinetics

    • Modification of HAMP domain to adjust signal gain

    • Engineering of protein-protein interaction interfaces for novel downstream connections

  • Synthetic biology applications:

    • Creation of cells with programmable directional movement toward non-native attractants

    • Development of bacterial biosensors for environmental monitoring

    • Engineering of cellular consortia with coordinated spatial organization

    • Design of feedback control systems with precise adaptation characteristics

  • Methodology for receptor engineering:

    • Structure-guided mutagenesis of binding pocket residues

    • Domain-swapping approaches with compatible receptors

    • High-throughput screening using chemotaxis-based selection

    • Computational design of binding interfaces

  • Validation approaches:

    • In vitro binding assays with purified periplasmic domains

    • Cellular reporter systems linked to receptor activation

    • Quantitative chemotaxis assays in defined gradients

    • Direct measurement of kinase activity in reconstituted systems

This engineering approach can produce novel biosensors for environmental monitoring, medical diagnostics, or create synthetic cellular systems with programmable spatial organization .

What are the implications of tas-mediated chemotaxis for biofilm formation and development of antimicrobial resistance in clinical settings?

The relationship between tas-mediated chemotaxis, biofilm formation, and antimicrobial resistance has significant clinical implications:

  • Biofilm initiation and development:

    • Chemotaxis directs initial bacterial attachment to favorable surfaces

    • Aspartate sensing may guide bacteria to nutrient-rich regions ideal for biofilm formation

    • Coordinated chemotactic responses could facilitate the development of structured biofilm communities

    • Chemotaxis-directed aggregation potentially increases initial attachment efficiency

  • Resistance mechanisms in biofilms:

    • Biofilm matrix creates diffusion barriers that reduce antibiotic penetration

    • Metabolic heterogeneity within biofilms creates persister cells with enhanced resistance

    • Cell density-dependent signaling in biofilms can upregulate efflux pumps

    • Horizontal gene transfer rates increase in biofilms, potentially spreading resistance genes

  • Clinical evidence:

    • Hospital outbreaks of E. aerogenes have been associated with biofilm-forming capabilities

    • Multidrug-resistant strains demonstrate enhanced surface attachment

    • Patient transfer has been linked to strain dissemination, suggesting environmental persistence

    • In vivo transfer of resistance plasmids has been documented in clinical settings

  • Potential intervention strategies:

    • Chemotaxis inhibitors could reduce initial biofilm formation

    • Receptor antagonists might disperse established biofilms

    • Combination therapies targeting both chemotaxis and conventional resistance mechanisms

    • Surface modifications to disrupt chemotactic cues that promote attachment

This research area has significant implications for developing novel approaches to combat persistent infections and reduce antimicrobial resistance in clinical settings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.