Recombinant Enterobacter aerogenes Quaternary ammonium compound-resistance protein qacF (qacF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Enterobacter aerogenes Quaternary Ammonium Compound-Resistance Protein QacF (QacF)

Enterobacter aerogenes is a bacterium known for its resistance to multiple antibiotics . Within this bacterium, the gene qacF encodes a protein, QacF, that confers resistance to quaternary ammonium compounds (QACs) . QacF is a multidrug exporter, implicated in resistance to bactericidal quaternary ammonium compounds .

Genetic Context and Characteristics

The qacF gene is located on a class 1 integron, In40, found on the plasmid pIP833 in E. aerogenes BM2688 . Integrons are genetic elements that can capture and express genes, often related to antibiotic resistance . In40 contains several gene cassettes, including aac(6′)-Ib, qacF, cmlA2, and oxa-9 .

The qacF gene encodes a protein of 110 amino acids . QacF shows a significant sequence identity (67.8%) to QacE, another quaternary ammonium compound-resistance protein .

Functional Aspects of QacF

QacF functions as a multidrug efflux pump, utilizing the proton motive force to transport substrates across the cell membrane . This mechanism allows the bacterium to resist the toxic effects of QACs by reducing their intracellular concentration .

Homology with Other Resistance Proteins

QacF shares notable sequence identity with other known resistance proteins :

  • 75% identity with QacE.

  • 37.6% with QacC, an antiseptic resistance protein from Staphylococcus aureus.

  • 70.1% with Ebr, an E. coli protein mediating resistance to ethidium bromide.

These proteins belong to a family of small multidrug export proteins that confer resistance to antiseptics and disinfectants .

Experimental Evidence of QacF Function

Experiments have demonstrated that QacF confers resistance to quaternary ammonium compounds . For example, E. coli JM83 expressing QacF showed a fourfold increase in resistance to cetyltrimethylammonium bromide (CTAB) compared to the control strain . The minimum inhibitory concentrations (MICs) of CTAB for E. coli JM83 and JM83/pAT672 (expressing QacF) were 100 and 400 mg/liter, respectively .

Prevalence and Co-occurrence with Other Resistance Genes

While QACs are widely used, Enterococcus isolates rarely carry QACs tolerance genes . When QACs tolerance genes are present, they are often found in close proximity to antibiotic and metal resistance genes . For example, Enterococcus spp. from clinical and environmental settings share qacZ genetic contexts that also carry aac(6′)-Ie-aph(2′′)-Ia, which codes for aminoglycoside resistance, insertion sequences, and recombinases .

Clinical and Environmental Significance

The presence of qacF and similar genes in bacteria like Enterobacter aerogenes has implications for the effectiveness of disinfectants and antiseptics . The ability of bacteria to develop resistance to these compounds can compromise infection control measures in healthcare and community settings . The co-occurrence of QAC resistance genes with other antimicrobial resistance genes further exacerbates the problem, potentially leading to multidrug-resistant strains .

Table: Comparison of QacF with Related Proteins

ProteinOrganismResistanceSequence Identity with QacF
QacEIntegron-associatedQuaternary ammonium compounds75%
QacCStaphylococcus aureusAntiseptics37.6%
EbrE. coliEthidium bromide70.1%

The Broader Context of QAC Resistance

Quaternary ammonium compounds (QACs) are frequently used in concentrations between 20 and 30,000 mg/L in community, healthcare, and food chain settings . Enterococcus faecalis and Enterococcus faecium are often found in these environments and are known as nosocomial pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
qacF; Quaternary ammonium compound-resistance protein QacF; Quaternary ammonium determinant F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Klebsiella aerogenes (Enterobacter aerogenes)
Target Names
qacF
Target Protein Sequence
MKNWIFLAVSIFGEVIATSALKSSHGFTRLVPSVVVVAGYGLAFYFLSLALKSIPVGIAY AVWAGLGIVLVAAIAWIFHGQKLDFWAFIGMGLIVSGVAVLNLLSKVSAH
Uniprot No.

Target Background

Function
Multidrug exporter implicated in resistance to bacteriocidal quaternary ammonium compounds.
Protein Families
Small multidrug resistance (SMR) protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the qacF gene and how does it contribute to antimicrobial resistance in Enterobacter aerogenes?

The qacF gene encodes a quaternary ammonium compound-resistance protein that confers resistance to antiseptics and disinfectants in Enterobacter aerogenes. It functions as part of an efflux pump system that reduces cellular accumulation of quaternary ammonium compounds by actively pumping them out of the bacterial cell. In E. aerogenes strain BM2688, the qacF gene was identified as one of four gene cassettes within the class 1 integron In40, alongside aac(6′)-Ib (aminoglycoside resistance), cmlA2 (chloramphenicol resistance), and oxa-9 (β-lactam resistance) . The presence of qacF contributes to the multidrug resistance profile of this opportunistic pathogen, potentially enabling its persistence in hospital environments where disinfectants are routinely used .

What is the genetic context of qacF in Enterobacter aerogenes?

In E. aerogenes strain BM2688, qacF is located within the class 1 integron In40 on plasmid pIP833. The integron contains four gene cassettes in the following order: aac(6′)-Ib, qacF, cmlA2, and oxa-9, followed by the characteristic class 1 integron components qacEΔ1 and sul1 . This genetic arrangement is significant because integrons facilitate the acquisition and expression of gene cassettes, contributing to the spread of antimicrobial resistance. The cassettes are typically transcribed from a promoter located in the 5′ conserved segment of the integron. This genomic context is crucial for understanding how resistance genes like qacF are mobilized, expressed, and transferred between bacteria .

What are the structural and functional differences between qacF and other quaternary ammonium compound resistance determinants?

The qacF protein belongs to the small multidrug resistance (SMR) family of membrane transporters, with structural features that distinguish it from other quaternary ammonium compound resistance determinants. While qacF shares significant sequence identity with qacE (67.8%), the two proteins differ in their substrate specificity profiles and efficiency in conferring resistance to various antiseptics .

Structurally, the qacF protein likely forms a homodimer with four transmembrane α-helices per monomer, creating a central pore through which quaternary ammonium compounds can be exported. The amino acid residues lining this pore determine substrate specificity, with hydrophobic and aromatic residues playing crucial roles in recognizing and binding quaternary ammonium compounds. Functional studies using site-directed mutagenesis have identified key residues that affect substrate binding and transport efficiency .

The table below summarizes the comparative characteristics of qacF and related quaternary ammonium resistance determinants:

CharacteristicqacFqacEqacEΔ1
Sequence identity to qacF100%67.8%Truncated version of qacE
Cassette contextUnique 59-base elementDifferent 59-base elementNot part of a mobile cassette
Genomic location in E. aerogenesIn40 integron on pIP833 plasmidNot typically found in E. aerogenesCommon in class 1 integrons
Resistance efficiency to QACsHighHighReduced compared to qacE
Evolutionary originIndependent cassette acquisitionIndependent cassette acquisitionDerived from qacE through deletion

How do recombination events affect the expression and function of qacF in clinical isolates?

Recombination events play a significant role in the expression and function of qacF in clinical isolates of E. aerogenes. The study of strain BM2688 and its derivative BM2688-1 revealed that large-scale deletions can occur between secondary recombination sites within integrons, potentially mediated by the integron integrase . In the case of BM2688-1, a 3,148-bp deletion resulted in the loss of aminoglycoside resistance while maintaining the presence of a modified integron structure .

These recombination events can significantly impact qacF expression through:

  • Alterations in promoter sequences that drive gene expression

  • Changes in the arrangement of gene cassettes that affect transcriptional read-through

  • Creation of fusion genes or truncated gene products with altered functions

  • Modifications to attenuators or other regulatory elements within the integron

Researchers have observed that while some recombination events are selected for during antibiotic therapy, others (like those in BM2688-1) occur spontaneously and may actually result in the loss of resistance determinants . This highlights the dynamic nature of integron structures and their role in bacterial adaptation to environmental pressures in clinical settings .

What methodological approaches are most effective for studying horizontal gene transfer of qacF between different bacterial species?

Several methodological approaches have proven effective for studying horizontal gene transfer of qacF between different bacterial species, particularly in clinical settings where such transfers can have significant implications for infection control:

  • Conjugation experiments: Direct measurement of plasmid transfer rates between donor and recipient strains under controlled laboratory conditions, using selective media to identify transconjugants carrying the qacF gene.

  • Whole-genome sequencing and comparative genomics: Analysis of plasmid sequences from different clinical isolates to identify identical or highly similar plasmids carrying qacF across different bacterial species. This approach was used to demonstrate the interspecies transmission of the plasmid-mediated blaKPC-3 gene between Klebsiella pneumoniae and E. aerogenes in a single patient .

  • Molecular typing of mobile genetic elements: PCR-based detection and characterization of integrons, transposons, and plasmids carrying qacF, combined with restriction fragment length polymorphism (RFLP) analysis to determine their structural similarities across different bacterial hosts.

  • Single-cell techniques: Fluorescence in situ hybridization (FISH) or fluorescently labeled plasmids to visualize and track plasmid transfer events in mixed bacterial populations or biofilms.

  • Transcriptomic and proteomic analyses: RNA-seq and mass spectrometry to assess the expression levels of qacF and associated genes under different growth conditions or in the presence of quaternary ammonium compounds .

What protocols are recommended for cloning and expressing recombinant qacF for functional studies?

For successful cloning and expression of recombinant qacF for functional studies, the following protocol is recommended:

  • Gene amplification:

    • Design primers that flank the qacF open reading frame with appropriate restriction sites

    • Use high-fidelity DNA polymerase (e.g., Phusion or Q5) for PCR amplification

    • Optimal PCR conditions: initial denaturation at 98°C for 30s, followed by 30 cycles of 98°C for 10s, 60°C for 30s, and 72°C for 30s, with a final extension at 72°C for 10 min

  • Cloning strategies:

    • For protein expression studies: Clone into pET vectors (e.g., pET28a) with an N-terminal His-tag for purification

    • For in vivo resistance studies: Clone into low-copy number vectors like pACYC184 under control of a constitutive or inducible promoter

    • For membrane protein topology studies: Consider fusion with reporter genes like phoA or gfp at various truncation points

  • Expression systems:

    • E. coli BL21(DE3) for high-level expression

    • For functional studies, consider using an E. coli strain deficient in endogenous efflux pumps (e.g., ΔacrAB)

    • Induce with 0.1-0.5 mM IPTG at 16-18°C overnight to facilitate proper membrane protein folding

  • Verification of expression:

    • Western blotting using anti-His antibodies

    • Confirm membrane localization using subcellular fractionation

    • Verify functional activity through minimum inhibitory concentration (MIC) assays against quaternary ammonium compounds

How can researchers effectively measure qacF-mediated resistance to quaternary ammonium compounds?

Researchers can effectively measure qacF-mediated resistance to quaternary ammonium compounds using several complementary approaches:

  • Minimum Inhibitory Concentration (MIC) Assays:

    • Perform broth microdilution assays according to CLSI guidelines

    • Use serial dilutions of quaternary ammonium compounds (benzalkonium chloride, cetrimide, cetylpyridinium chloride)

    • Compare MICs between qacF-expressing strains and control strains

    • Include positive controls (strains expressing known resistance determinants like qacE)

  • Efflux Pump Inhibition Assays:

    • Measure MICs in the presence and absence of efflux pump inhibitors (e.g., carbonyl cyanide m-chlorophenylhydrazone (CCCP))

    • A significant reduction in MIC with inhibitors confirms the role of active efflux

  • Fluorescent Dye Accumulation Assays:

    • Use fluorescent quaternary ammonium compounds like ethidium bromide or Hoechst 33342

    • Monitor fluorescence over time in a microplate reader

    • Lower fluorescence in qacF-expressing cells indicates active efflux

  • Time-Kill Kinetics:

    • Expose bacteria to sub-lethal concentrations of quaternary ammonium compounds

    • Plot survival curves over time (0, 5, 10, 15, 30, 60 minutes)

    • qacF-expressing strains will show extended survival compared to controls

  • Gene Expression Analysis:

    • Use RT-qPCR to measure qacF expression levels under different conditions

    • Correlate expression levels with resistance phenotypes

The table below shows typical MIC ranges for various quaternary ammonium compounds in qacF-positive and qacF-negative E. aerogenes strains:

Quaternary Ammonium CompoundMIC Range for qacF-positive strains (μg/ml)MIC Range for qacF-negative strains (μg/ml)Fold Increase
Benzalkonium chloride32-644-88
Cetrimide16-322-48
Cetylpyridinium chloride8-161-28
Chlorhexidine4-82-42

What strategies can be employed to study the evolutionary relationships between qacF and related quaternary ammonium resistance genes?

To study the evolutionary relationships between qacF and related quaternary ammonium resistance genes, researchers can employ several sophisticated strategies:

  • Phylogenetic Analysis:

    • Collect nucleotide and amino acid sequences of qacF, qacE, and related genes from public databases

    • Perform multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Construct phylogenetic trees using maximum likelihood or Bayesian inference methods

    • Evaluate node support through bootstrap analysis or posterior probabilities

    • Use molecular clock analyses to estimate divergence times

  • Comparative Genomics:

    • Analyze the genomic context of qacF and related genes across different bacterial species

    • Identify conserved and variable regions in the flanking sequences

    • Map the distribution of these genes on a species phylogeny to detect horizontal gene transfer events

    • Use tools like Mauve or ACT for genome alignment visualization

  • Cassette Structure Analysis:

    • Compare the 59-base elements of qacF and qacE cassettes

    • Analyze attC sites for recombination efficiency with integron integrases

    • Examine palindromic sequences and secondary structures that may influence cassette mobility

  • Experimental Evolution:

    • Subject bacteria carrying qacF to increasing concentrations of quaternary ammonium compounds

    • Sequence evolved strains to identify mutations in qacF or regulatory elements

    • Perform complementation studies with ancestral and evolved variants

  • Ancestral Sequence Reconstruction:

    • Infer the sequence of the common ancestor of qacF and qacE

    • Synthesize and express the reconstructed ancestral gene

    • Compare functional properties with extant variants to understand evolutionary trajectories

How can the understanding of qacF contribute to addressing antimicrobial resistance in clinical settings?

Understanding qacF and its role in quaternary ammonium compound resistance has several important implications for addressing antimicrobial resistance in clinical settings:

  • Improved Disinfection Protocols:

    • Knowledge of qacF prevalence can inform the selection of appropriate disinfectants in healthcare facilities

    • Rotation strategies for different classes of biocides can be implemented to prevent resistance development

    • Concentration and contact time recommendations can be optimized based on the resistance mechanisms conferred by qacF

  • Surveillance and Risk Assessment:

    • Screening clinical isolates for qacF can serve as a marker for potential reduced susceptibility to disinfectants

    • Monitoring the co-occurrence of qacF with antibiotic resistance genes can identify high-risk strains

    • Environmental sampling can identify reservoirs of resistant organisms in healthcare settings

  • Development of Novel Antimicrobials:

    • Structural understanding of QacF protein can guide the design of new quaternary ammonium compounds that evade efflux

    • Identification of inhibitors targeting QacF function could restore susceptibility to existing disinfectants

    • Combination approaches using efflux pump inhibitors with biocides may overcome resistance

  • Infection Control Strategies:

    • Implementation of enhanced cleaning protocols in areas where qacF-positive organisms are prevalent

    • Development of biofilm eradication strategies that account for efflux-mediated resistance

    • Education of healthcare personnel about the importance of correct disinfectant use to prevent resistance

What are the current challenges in developing inhibitors targeting QacF-mediated resistance?

Developing inhibitors targeting QacF-mediated resistance faces several significant challenges:

  • Structural Complexity:

    • QacF is a membrane protein, making structural determination challenging

    • Limited high-resolution structural data impedes structure-based drug design

    • The small size of the protein provides few potential binding pockets for inhibitor design

  • Specificity Issues:

    • Inhibitors must be specific to QacF without affecting human membrane transporters

    • Cross-reactivity with other bacterial SMR family proteins may lead to broad selection pressure

    • Distinguishing between closely related efflux pumps (QacF vs. QacE) requires highly specific approaches

  • Delivery Challenges:

    • Inhibitors must penetrate the outer membrane of Gram-negative bacteria

    • Compounds targeting membrane proteins often have physicochemical properties that limit bioavailability

    • Achieving sufficient local concentration at the site of QacF localization is difficult

  • Resistance Development:

    • Bacteria may develop resistance to inhibitors through mutations in qacF

    • Alternative efflux systems may be upregulated to compensate for QacF inhibition

    • The presence of multiple resistance mechanisms may reduce inhibitor effectiveness

  • Methodological Limitations:

    • Lack of standardized assays for screening potential inhibitors

    • Difficulty in distinguishing between direct QacF inhibition and non-specific effects

    • Challenges in translating in vitro efficacy to in vivo and clinical applications

What emerging technologies and approaches show promise for studying qacF gene expression and regulation?

Several emerging technologies and approaches show considerable promise for advancing our understanding of qacF gene expression and regulation:

  • Single-Cell Transcriptomics:

    • RNA-seq at the single-cell level can reveal heterogeneity in qacF expression within bacterial populations

    • Identification of subpopulations with different expression levels may explain persistence after disinfection

    • Correlation of expression patterns with cell state and microenvironment

  • CRISPR-Cas Based Technologies:

    • CRISPR interference (CRISPRi) for precise modulation of qacF expression

    • CRISPR activation (CRISPRa) to study the effects of overexpression

    • Base editing to introduce specific mutations for structure-function studies

    • Genetic screens to identify regulators of qacF expression

  • Nanopore Direct RNA Sequencing:

    • Long-read RNA sequencing to determine the complete transcriptional unit containing qacF

    • Detection of post-transcriptional modifications that may affect mRNA stability

    • Identification of antisense transcripts or small RNAs that regulate qacF

  • Proteomics and Interactomics:

    • Proximity labeling methods (BioID, APEX) to identify proteins interacting with QacF

    • Quantitative proteomics to measure changes in the membrane proteome in response to QacF expression

    • Crosslinking mass spectrometry to determine QacF structure and interactions

  • Biosensors and Reporter Systems:

    • Development of real-time reporters for qacF expression using fluorescent proteins

    • Biosensors that detect quaternary ammonium compounds and activate reporter gene expression

    • Microfluidic systems to study qacF expression dynamics under controlled gradients of disinfectants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.