Recombinant Enterobacter agglomerans Mercuric transport protein (merT)

Shipped with Ice Packs
In Stock

Description

Operon Structure and Genetic Context

The mer operon in Enterobacter agglomerans includes genes merRTPCADE, where merR regulates operon expression, and merC enhances Hg²⁺ transport efficiency . Comparative studies show:

SpeciesOperon CompositionKey Transport ProteinsResistance Spectrum
Enterobacter agglomeransmerRTPCADEmerT, merP, merCBroad (Hg²⁺ + organics)
Pseudomonas fluorescensmerRTPADEmerT, merP, merDNarrow (Hg²⁺ only)

Bioremediation Potential

Recombinant merT has been explored for enhancing mercury uptake in engineered bacteria. For example, Pseudomonas pseudoalcaligenes strains overexpressing merT showed improved Hg²⁺ bioremediation capacity in marine environments . In Enterobacter sp. YSU, the cloned merRTPCADE operon conferred resistance to 150 µM HgCl₂, highlighting its applicability in heavy-metal contaminated sites .

ELISA and Bioassay Tools

Recombinant merT is used in enzyme-linked immunosorbent assays (ELISA) to study mercury transport mechanisms and monitor environmental mercury levels. Key specifications for commercial ELISA kits include:

ParameterDetailSource
Protein Quantity50 µg per vial
Purity>90% (SDS-PAGE validated)
Storage-20°C/-80°C (with aliquoting recommended)

Phylogenetic Analysis

Phylogenetic studies using MEGA 7 software reveal that Enterobacter merT clusters with other Enterobacteriaceae proteins, distinct from Pseudomonadaceae homologs . This divergence reflects species-specific adaptations in mercury resistance mechanisms.

Mechanistic and Comparative Data

The Hg²⁺ transport pathway involves sequential interactions:

  1. merP binds Hg²⁺ in the periplasm.

  2. merT transfers Hg²⁺ to the inner membrane.

  3. merA reduces Hg²⁺ to Hg⁰, which diffuses out as a gas .

In contrast, organomercurial lyase (merB) cleaves carbon-mercury bonds, making merB-containing operons effective against methylmercury and phenylmercury . The absence of merB in some Stenotrophomonas strains limits their organomercury resistance .

Challenges and Future Directions

While recombinant merT enhances bacterial mercury tolerance, challenges include:

  • Operon instability: Horizontal gene transfer risks environmental spread of mercury resistance.

  • Tag interference: His-tagged variants may alter transport efficiency .

Future research may focus on optimizing merT expression in bioengineered systems or developing tag-free variants for improved bioremediation efficacy.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its incorporation.
Synonyms
merT; Mercuric transport protein MerT; Mercury ion transport protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans)
Target Names
merT
Target Protein Sequence
MSEPQKSEPQKSEPQNGRGALFAGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPY RPIFIGAALVALFFAWRRIYRPAQACKPGEVCAIPQVRATYKLIFWIVAALVLVSLGFPY VMPFFY
Uniprot No.

Target Background

Function
This protein is involved in mercury resistance. It is believed to facilitate the transfer of mercuric ions from the periplasmic Hg(II)-binding protein MerP to the cytoplasmic mercuric reductase MerA.
Protein Families
MerT family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.