Recombinant Enterobacter sp. ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Enterobacter sp. ATP Synthase Subunit a (atpB)

Recombinant Enterobacter sp. ATP synthase subunit a (atpB) is a laboratory-produced protein that mimics the naturally occurring subunit a component of the ATP synthase complex found in Enterobacter species. ATP synthases of F-type (FOF1) are embedded in bacterial cellular membranes, thylakoid membranes of chloroplasts, and mitochondrial inner membranes of eukaryotes, where they perform the critical function of ATP synthesis and regulation of transmembrane potential . The atpB subunit, specifically, is a membrane-integral component of the FO portion of the ATP synthase complex that plays a crucial role in proton translocation across the membrane, which ultimately drives ATP synthesis .

Enterobacter species belong to the Enterobacteriaceae family, a large group of Gram-negative bacteria comprising over 30 genera and more than 100 species . As facultative anaerobes, Enterobacteriaceae can ferment sugars to produce lactic acid and various other end products, with many members serving as normal components of the gut microbiota in humans and other animals . The ATP synthase complex, including the atpB subunit, is essential for energy metabolism in these bacteria.

Significance in Bacterial Bioenergetics

The ATP synthase complex represents one of the most fundamental and conserved macromolecular assemblies in living organisms, serving as the principal mechanism for cellular energy production. Within this complex, the atpB subunit forms a critical part of the proton channel that couples the electrochemical gradient across the membrane to the mechanical rotation of the enzyme, ultimately leading to ATP synthesis . Understanding the structure and function of recombinant Enterobacter sp. ATP synthase subunit a (atpB) provides valuable insights into bacterial bioenergetics and potential targets for antimicrobial development, particularly relevant given the increasing clinical significance of Enterobacter infections .

Physicochemical Properties

As a membrane-integral protein, atpB exhibits hydrophobic characteristics necessary for its insertion and function within the lipid bilayer. The protein is typically prepared as a lyophilized powder for storage and research applications, with recommended reconstitution protocols to maintain its structural integrity . The predominantly hydrophobic nature of the protein aligns with its functional role in forming part of the proton channel within the membrane sector of the ATP synthase complex.

Table 1: Key Characteristics of Recombinant Enterobacter sp. ATP synthase subunit a (atpB)

PropertyDescription
SpeciesEnterobacter sp.
Expression SystemE. coli
Protein LengthFull Length (1-271 amino acids)
Molecular TagN-terminal His tag
FormLyophilized powder
Purity>90% (SDS-PAGE verified)
UniProt IDA4WGE9
SynonymsATP synthase F0 sector subunit a, F-ATPase subunit 6

Production and Purification Methods

The production of recombinant Enterobacter sp. ATP synthase subunit a (atpB) typically employs heterologous expression systems, with Escherichia coli being the predominant host organism due to its ease of genetic manipulation, rapid growth, and high protein yields . The gene encoding the atpB protein is cloned into an appropriate expression vector, which is then transformed into E. coli cells for protein production.

Expression and Isolation

The expression of recombinant atpB protein often incorporates an N-terminal histidine tag, which facilitates subsequent purification using affinity chromatography techniques. Following cell culture and protein expression, the cells are harvested and disrupted to release the recombinant protein. Given the membrane-associated nature of atpB, specialized extraction protocols involving detergents are typically employed to solubilize the protein from the membrane fraction .

Purification and Quality Control

Purification of the His-tagged recombinant atpB protein generally involves immobilized metal affinity chromatography (IMAC), where the histidine residues bind to immobilized metal ions such as nickel or cobalt. Following elution, additional purification steps may include ion-exchange chromatography and size-exclusion chromatography to achieve high purity. Quality control assessments typically include SDS-PAGE analysis to confirm protein size and purity, with standards generally requiring greater than 90% purity for research applications .

Role in ATP Synthesis

The ATP synthase complex consists of two major domains: F1, the water-soluble catalytic domain, and FO, the membrane-embedded proton channel. These domains are connected by central and peripheral stalks that facilitate the coupling of proton translocation to ATP synthesis . Within this complex, subunit a (atpB) forms a critical component of the FO domain, which is responsible for proton translocation across the membrane.

The fundamental mechanism of ATP synthesis involves the flow of protons through the FO domain along the electrochemical gradient established across the membrane during cellular respiration or photosynthesis. This proton flow drives the rotation of the c-ring within the FO domain, which is mechanically coupled to the rotation of the central stalk. The rotating central stalk triggers conformational changes in the catalytic α3β3 hexamer of the F1 domain, leading to ATP synthesis at the interface between α and β subunits .

Subunit a (atpB) specifically interacts with the c-ring subunits to form the proton channel, providing the pathway for protons to enter and exit the FO domain. The precise arrangement of key residues within subunit a creates the half-channels necessary for proton translocation, making this subunit essential for the coupling of proton flow to rotational movement .

Importance in Enterobacter Metabolism

As members of the Enterobacteriaceae family, Enterobacter species are facultative anaerobes capable of both aerobic respiration and fermentation . During aerobic respiration, the ATP synthase complex, including the atpB subunit, plays a crucial role in energy production by harnessing the proton gradient established across the bacterial membrane during electron transport.

The efficiency of ATP production via oxidative phosphorylation is significantly higher than that achieved through fermentation, making the ATP synthase complex, and by extension the atpB subunit, vital for optimal energy metabolism under aerobic conditions. Furthermore, the ATP synthase complex may contribute to bacterial adaptation to changing environmental conditions, potentially influencing survival and virulence in pathogenic Enterobacter species .

Antimicrobial Development

The essential nature of ATP synthase for bacterial survival, coupled with structural and functional differences between bacterial and human ATP synthases, positions this enzyme complex as a potential target for novel antimicrobial compounds . Recombinant Enterobacter sp. ATP synthase subunit a (atpB) can facilitate high-throughput screening of compound libraries to identify inhibitors that specifically target bacterial ATP synthases.

Given the increasing clinical significance of Enterobacter infections and the rising trend of antibiotic resistance among Enterobacteriaceae , the development of ATP synthase-targeted antimicrobials represents a promising avenue for addressing these healthcare challenges. The availability of purified recombinant atpB protein enables the rational design and evaluation of such inhibitors through structure-based drug discovery approaches .

Comparative Analysis with ATP Synthase Subunits from Other Species

The ATP synthase complex, while functionally conserved across diverse organisms, exhibits notable structural variations that reflect evolutionary adaptations to different cellular environments and energetic requirements. Comparative analyses of ATP synthase subunits from various species provide valuable insights into the conservation of core functional elements and the diversification of regulatory mechanisms.

Evolutionary Implications

The structural and functional divergence of ATP synthase subunits across different taxonomic groups reflects evolutionary adaptations to diverse ecological niches and metabolic requirements. Within the Enterobacteriaceae family, which includes over 30 genera and more than 100 species , variations in ATP synthase components may contribute to the remarkable ecological versatility of these bacteria, enabling them to thrive in environments ranging from the human gut to soil and water.

Phylogenetic analyses incorporating sequence data from recombinant Enterobacter sp. ATP synthase subunit a (atpB) and homologous proteins from related species can provide insights into the evolutionary history of this essential enzyme complex, potentially revealing patterns of adaptive evolution in response to specific environmental challenges.

Clinical Relevance and Antibiotic Resistance

The clinical significance of Enterobacter species has been increasingly recognized, with epidemiological studies documenting a rising trend of Enterobacter infections in healthcare settings . Analysis of clinical isolates has revealed concerning patterns of antibiotic resistance, including the emergence of extended-spectrum beta-lactamase (ESBL) producers and multidrug-resistant (MDR) strains .

A comprehensive study conducted over a 2.5-year period identified 109 Enterobacter species isolates from clinical samples, with a predominance of infections in the 41-60 year age group (33.94%) and a higher incidence among male patients (64.22%) . The study documented increasing rates of ESBL producers (from 43.90% to 52%) and MDR isolates (from 10% to 17%) over the observation period, highlighting the evolving challenge of antibiotic resistance in Enterobacter infections .

Table 2: Antibiotic Resistance Profile of Enterobacter species (2017-2019)

Antibiotic2017 (% Resistant)2018 (% Resistant)2019 (Until June) (% Resistant)
Ceftriaxone51.7243.9052.00
Piperacillin-Tazobactam~18.31*~18.31*~18.31*
Imipenem~21.73*~21.73*~21.73*
Meropenem~12.58*~12.58*~12.58*
Cefoperazone-Sulbactam~15.26*~15.26*~15.26*

These clinical findings underscore the potential value of ATP synthase-targeted antimicrobials as an alternative therapeutic strategy for addressing the challenge of antibiotic resistance in Enterobacter infections. The availability of recombinant Enterobacter sp. ATP synthase subunit a (atpB) facilitates the exploration of this promising avenue for drug discovery.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; Ent638_4126; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
atpB
Target Protein Sequence
MASENMTPQDYIGHHLTNLQMDLRTFSLVDPHNPPATFWTLNIDSMFFSVVLGLLFLAMF RSVAKKATSGVPGKFQTAIELVIGFVHGSVKDMYHGKSKLIAPLALTVFVWVFLMNLMDL LPIDLLPYIGEHVFGLPALRVVPSADVNITLSMALGVFILILFYSIKMKGVSGFVKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase in Enterobacter species?

ATP synthase in Enterobacter species, like other bacterial F-type ATP synthases, consists of two primary domains: F₀ (membrane-embedded) and F₁ (catalytic). The structure follows the general bacterial pattern with subunit composition α₃β₃γδεab₂c₈-15.

The F₀ domain (containing subunit a) forms the proton channel across the membrane, while the F₁ domain (containing the β subunit encoded by atpB) contains the catalytic sites for ATP synthesis . The enzyme functions as a rotary molecular machine where proton flow through F₀ drives rotation of the c-ring, which couples to the central stalk (γ subunit) to induce conformational changes in the F₁ catalytic sites that synthesize ATP .

Unlike some specialized bacterial ATP synthases that use Na⁺ ions, Enterobacter ATP synthase primarily utilizes H⁺ as the coupling ion . The enzyme can operate bidirectionally, either synthesizing ATP using the proton motive force or hydrolyzing ATP to generate a proton gradient .

What expression systems are recommended for producing recombinant Enterobacter ATP synthase components?

Based on established protocols for bacterial ATP synthases, the preferred expression system for Enterobacter ATP synthase components is Escherichia coli, particularly strain DK8 (lacking endogenous ATP synthase). This approach was successfully employed for ATP synthases from other bacteria .

For expression, the following methodology is recommended:

  • Clone the desired ATP synthase genes or operons into expression vectors with inducible promoters (e.g., pTrc99a)

  • Transform into E. coli DK8 host cells

  • Induce expression at mid-logarithmic growth phase

  • Harvest cells and isolate membrane fractions or purify the complete complex depending on experimental needs

For improved purification, adding a His₆-tag to the N-terminus of the β subunit (encoded by atpB) facilitates affinity chromatography without significantly affecting enzyme function . Expression typically yields 2-5 mg of purified protein per liter of culture.

How can I assess the catalytic activity of recombinant Enterobacter ATP synthase in vitro?

Several complementary assays can measure ATP synthase activity:

ATP Synthesis Assay:

  • Reconstitute purified ATP synthase into liposomes (protein-to-lipid ratio of 1:50 w/w)

  • Create an artificial proton motive force using:

    • pH jump method: Incubate proteoliposomes at pH 5.5, then rapidly transfer to pH 8.4 buffer

    • K⁺ diffusion potential: Generate Δψ (typically 160 mV) using valinomycin in the presence of a K⁺ gradient

  • Add ADP and Pi (typically 200 μM ADP and 5 mM Pi)

  • Measure ATP formation using luciferase assay or HPLC

ATP Hydrolysis Assay:

  • Measure inorganic phosphate release using malachite green or EnzChek phosphate assay

  • Couple ATP hydrolysis to NADH oxidation through pyruvate kinase and lactate dehydrogenase

  • Monitor change in absorbance at 340 nm

Typical activity values for bacterial ATP synthases are:

  • ATP synthesis: 10-100 nmol·min⁻¹·mg protein⁻¹

  • ATP hydrolysis: 1-5 μmol·min⁻¹·mg protein⁻¹

Notably, like other enterobacterial ATP synthases, Enterobacter ATP synthase shows latent ATPase activity, which can be regulated by the ε subunit .

What are the key mutations that affect ATP synthase function in Enterobacter species?

Several key residues in Enterobacter ATP synthase subunits significantly impact function when mutated:

In subunit a (F₀):

  • Conserved Arg residue in TMH4 (equivalent to Arg-210 in E. coli): Critical for preventing proton short-circuiting and essential for coupling proton translocation to rotation

  • Residues forming the proton half-channels: Mutations disrupt proton translocation, completely blocking enzyme function

In subunit β (encoded by atpB):

  • Catalytic residues involved in ATP binding and hydrolysis

  • Residues at interfaces with the γ subunit that affect coupling efficiency

In subunit ε:

  • C-terminal domain residues: Affect the regulatory inhibition of ATP hydrolysis while permitting ATP synthesis

Table 1: Critical Mutations Affecting ATP Synthase Function

SubunitResidue PositionEffect of Mutation
aArg-210 equivalentComplete loss of coupling
aProton half-channel residuesDisrupted proton translocation
β (atpB)Catalytic site residuesReduced ATP synthesis/hydrolysis
β (atpB)γ-interface residuesImpaired coupling efficiency
εC-terminal residuesAltered regulation of ATP hydrolysis

How do the mechanisms of inhibition differ between Enterobacter ATP synthase and other bacterial ATP synthases?

Enterobacter ATP synthase shares common inhibition mechanisms with other bacterial ATP synthases but exhibits distinct characteristics:

  • ε Subunit Inhibition:

    • Like other enterobacterial ATP synthases, Enterobacter ATP synthase is regulated by the C-terminal domain of the ε subunit

    • The ε subunit adopts an "up" conformation that inhibits ATP hydrolysis while permitting ATP synthesis

    • Unlike Bacillus PS3, where inhibition depends on ATP concentration (inhibition at <0.7 mM ATP, permissive at >1 mM ATP), Enterobacter follows the E. coli pattern where inhibition persists even at high ATP concentrations in the absence of sufficient proton motive force

  • Inhibitor Sensitivity:

    • Enterobacter ATP synthase likely shares sensitivity to efrapeptin with other enterobacterial ATP synthases, unlike some thermophilic bacterial enzymes that show resistance

    • It exhibits differential sensitivity to resveratrol and piceatannol compared to thermophilic bacterial ATP synthases

  • Regulatory Mechanisms:

    • The ATP biosensor studies indicate that ATP dynamics in Enterobacter and related bacteria show transient ATP accumulation during the transition from exponential to stationary growth phases

    • The ATP dynamics differ based on carbon source, with higher ATP levels observed during growth on acetate compared to glucose, contrary to expected ATP yields per carbon source

What approaches can be used to study proton translocation through the a-subunit in recombinant Enterobacter ATP synthase?

Studying proton translocation through the a-subunit requires sophisticated methodologies:

  • Reconstitution and Fluorescence Assays:

    • Reconstitute purified ATP synthase into liposomes containing pH-sensitive fluorophores (ACMA or pyranine)

    • Monitor fluorescence changes upon energization with ATP or an artificial proton gradient

    • Calculate H⁺/ATP ratio by correlating proton uptake with ATP synthesis or hydrolysis

  • Site-Directed Mutagenesis Combined with Functional Assays:

    • Generate systematic mutations in conserved residues of the a-subunit

    • Assess impact on proton translocation, ATP synthesis, and ATP hydrolysis

    • Map the proton pathway based on mutational effects

  • Molecular Dynamics Simulations:

    • Create atomistic models of the a-subunit and c-ring interface

    • Simulate proton movement through the half-channels

    • Identify key residues and water molecules involved in proton transfer

  • Cryo-EM Structural Analysis:

    • Determine high-resolution structures of the intact ATP synthase in different rotational states

    • Identify conformational changes in the a-subunit that facilitate proton translocation

    • Compare with established models from E. coli and other bacterial systems

How can ATP dynamics be monitored in living Enterobacter cells, and what insights does this provide about metabolic regulation?

Advanced techniques for monitoring ATP dynamics in living Enterobacter cells include:

  • Genetically Encoded ATP Biosensors:

    • Transform Enterobacter with plasmids expressing ATP biosensors like iATPsnFR1.1

    • These biosensors contain a circularly permuted super-folder green fluorescent protein (cp-sfGFP) integrated within the ATP-binding domain

    • ATP binding induces conformational changes leading to enhanced fluorescence

    • To normalize for expression levels, fuse mCherry to the sensor and calculate GFP/mCherry ratio

  • Real-time Monitoring Setup:

    • Use microfluidic devices to control environmental conditions

    • Perform time-lapse fluorescence microscopy with controlled media exchange

    • Monitor cells across growth phases and under different carbon sources

  • Data Analysis and Interpretation:

Recent findings using these approaches revealed:

  • Transient ATP accumulation during the transition from exponential to stationary growth phases

  • Different steady-state ATP levels during growth on different carbon sources

  • Counterintuitive higher ATP levels during growth on acetate compared to glucose

  • ATP production-consumption imbalances driving the observed dynamics

This methodology provides insights into:

  • Metabolic regulation during different growth phases

  • Energy allocation during stress responses

  • Potential targets for antimicrobial development

  • Correlations between ATP levels and production of specific metabolites

How can recombinant Enterobacter ATP synthase be leveraged for drug discovery against multidrug-resistant strains?

ATP synthase represents an attractive target for developing antimicrobials against multidrug-resistant Enterobacter strains, which are part of the ESKAPE pathogens of clinical concern . Research approaches include:

  • Structure-Based Drug Design:

    • Utilize high-resolution structures of ATP synthase to identify unique binding sites

    • Focus on the a-subunit and c-ring interface, which shows species-specific features

    • Target ATP synthase regulatory mechanisms specific to Enterobacter species

  • Peptide Inhibitor Development:

    • Engineer peptide fragments from ATP synthase interfaces using evolutionary algorithms like ROSE

    • Assess protein-protein interactions using predictors like PPI-Detect

    • Evaluate inhibitory potency through in vitro assays

  • Screening Methodology:

    • Establish high-throughput ATP synthesis/hydrolysis assays with recombinant enzyme

    • Screen compound libraries against purified enzyme and whole cells

    • Validate hits through binding assays (ITC, MST) and structural studies

  • Differential Targeting Strategy:

    • Identify inhibitors that selectively target bacterial ATP synthases over human mitochondrial counterparts

    • Focus on structural differences in the a-subunit and regulatory elements

What are the technical challenges in expressing and purifying functional recombinant ATP synthase from Enterobacter species?

Researchers face several technical challenges when working with recombinant Enterobacter ATP synthase:

  • Expression Challenges:

    • Maintaining the correct stoichiometry of multiple subunits

    • Ensuring proper membrane insertion of the F₀ portion

    • Preventing toxicity to the host from overexpression of membrane proteins

  • Purification Challenges:

    • Extracting the intact complex from membranes without disrupting subunit interactions

    • Selecting appropriate detergents that maintain enzyme activity

    • Removing endogenous lipids while preserving structure

  • Reconstitution Issues:

    • Achieving uniform orientation in liposomes

    • Maintaining the proton-tight seal necessary for activity

    • Ensuring consistent proteoliposome size and protein incorporation

Recommended Approach:

  • Co-express all subunits from a single operon under controlled induction

  • Use a two-step purification: Ni-affinity followed by size exclusion chromatography

  • Reconstitute using a detergent removal method (e.g., Bio-Beads) rather than dialysis

  • Verify function through multiple complementary assays

How does ATP synthase contribute to antimicrobial resistance mechanisms in Enterobacter species?

  • Energy Provision for Efflux Pumps:

    • ATP synthase supplies the energy required for ATP-dependent efflux pumps that export antibiotics

    • MDR Enterobacter strains often upregulate both ATP synthase and efflux systems

  • Adaptation to Environmental Stresses:

    • ATP synthase regulation allows bacteria to adapt to environmental challenges

    • Transient ATP accumulation during stress responses may contribute to survival during antibiotic exposure

  • Metabolic Flexibility:

    • The ability to modulate ATP synthesis rates in response to different carbon sources

    • Contributes to adaptation under antibiotic pressure and host environments

  • Biofilm Formation:

    • ATP availability influences biofilm formation, a key resistance mechanism

    • Energy allocation during the transition from planktonic to biofilm growth involves ATP synthase regulation

How might novel biosensor technologies enhance our understanding of ATP synthase function in Enterobacter species?

Future research using emerging biosensor technologies could provide unprecedented insights into Enterobacter ATP synthase:

  • Single-Molecule Rotation Assays:

    • Attach fluorescent beads or quantum dots to the rotor portion

    • Immobilize the stator portion on a surface

    • Directly visualize rotation under different conditions

    • Measure torque generation and step sizes during ATP synthesis and hydrolysis

  • FRET-Based Conformational Sensors:

    • Introduce FRET pairs at strategic locations in different subunits

    • Monitor real-time conformational changes during catalysis

    • Correlate structural transitions with catalytic events

  • Spatiotemporal ATP Imaging:

    • Deploy genetically encoded ATP sensors throughout bacterial cells

    • Map ATP concentration gradients near the membrane and in different cellular compartments

    • Correlate with metabolic state and antimicrobial responses

  • Combined Electrical and Optical Measurements:

    • Simultaneously measure proton currents and ATP synthesis/hydrolysis

    • Determine precise H⁺/ATP ratios under different conditions

    • Assess efficiency of energy conversion in wild-type and mutant enzymes

These approaches would allow researchers to address fundamental questions about ATP synthase operation in living Enterobacter cells and potentially identify new targets for antimicrobial development.

What insights can comparative studies between Enterobacter ATP synthase and other bacterial ATP synthases provide for evolutionary biology?

Comparative studies of ATP synthases across bacterial species offer valuable evolutionary insights:

  • Phylogenetic Analysis:

    • Compare ATP synthase sequences across Enterobacteriaceae family members

    • Identify conserved functional domains versus species-specific adaptations

    • Trace the evolution of regulatory mechanisms like ε subunit inhibition

  • Structural Adaptations:

    • Compare c-ring stoichiometry between species (which affects H⁺/ATP ratio)

    • Analyze differences in proton channels and catalytic sites

    • Identify structural features that reflect adaptation to specific ecological niches

  • Functional Divergence:

    • Compare kinetic parameters across species

    • Assess differences in regulatory mechanisms

    • Evaluate environmental responsiveness of ATP synthesis/hydrolysis

For Enterobacter specifically, comparisons with other ESKAPE pathogens could reveal how ATP synthase function correlates with pathogenicity and host adaptation. Current evidence suggests that while core catalytic mechanisms are conserved, regulatory elements like the ε subunit show significant species-specific adaptations that likely reflect different ecological pressures .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.