Recombinant Enterobacter sp. ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
atpF; Ent638_4128; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
atpF
Target Protein Sequence
MNMNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQAN ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembranous catalytic core, and F0, the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What expression systems are most suitable for recombinant production of Enterobacter sp. atpF?

When expressing the atpF gene individually, it's advisable to optimize temperature (typically 18-25°C), inducer concentration (0.1-0.5 mM IPTG for T7-based systems), and use specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression. In cases where individual expression results in poor solubility, a bicistonic approach—similar to that used for γε subunits where co-expression significantly improved protein solubility—may be beneficial . This approach involves co-expressing atpF with interacting partners such as subunit δ.

What is the optimal protocol for purifying recombinant Enterobacter atpF protein?

The optimal protocol for purifying recombinant Enterobacter atpF protein involves a multi-step process designed to maintain protein structure and function. Based on successful purification strategies for ATP synthase subunits, the following methodology is recommended:

  • Cell Lysis: Harvest cells expressing the His-tagged atpF protein and resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 5 mM MgCl₂, 1 mM PMSF, and 10% glycerol).

  • Membrane Extraction: Since subunit b is membrane-associated, include 1% mild detergent (n-dodecyl β-D-maltoside or CHAPS) in the lysis buffer to solubilize membrane proteins.

  • Initial Purification: Apply the clarified lysate to Ni-NTA affinity chromatography, wash with increasing imidazole concentrations (10-50 mM), and elute the protein with 250-300 mM imidazole.

  • Secondary Purification: Further purify using size exclusion chromatography with a column suitable for proteins in the 10-700 kDa range (similar to what was used for other ATP synthase subunits) .

  • Stabilization: Add 2 mM ATP and 2 mM MgCl₂ to all buffers, as these additives have proven crucial for the stability of ATP synthase subunits during purification and assembly studies .

The purified protein should be analyzed by SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity. This protocol typically yields 2-5 mg of purified protein per liter of bacterial culture with >90% purity.

How can researchers assess the functional activity of recombinant atpF in vitro?

Assessing the functional activity of recombinant atpF in vitro requires evaluating its ability to interact with other ATP synthase subunits and contribute to complex assembly. The following methodological approaches are recommended:

  • Protein-Protein Interaction Assays:

    • Co-immunoprecipitation with other ATP synthase subunits, particularly the δ subunit

    • Surface plasmon resonance (SPR) to quantify binding affinity

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of interactions

  • Complex Assembly Analysis:

    • Size exclusion chromatography (SEC) to monitor formation of higher-order complexes

    • LILBID-MS (laser-induced liquid bead ion desorption mass spectrometry) to determine subcomplex stoichiometry when atpF is incubated with other subunits

    • Analytical ultracentrifugation to assess complex formation

  • Functional Reconstitution:

    • Incorporation of purified atpF into liposomes with other F₀ subunits to assess proton translocation

    • Complementation assays using ATP synthase-deficient bacterial strains

When conducting these experiments, it's crucial to include 2 mM ATP and 2 mM MgCl₂ in all buffers, as these components have been shown to be essential for proper subunit interactions and complex stability in F-type ATP synthases .

What methods are recommended for studying the interaction between subunit b and other components of the ATP synthase complex?

To study the interaction between subunit b and other components of the ATP synthase complex, researchers should employ a multi-faceted approach combining biochemical, biophysical, and structural methods:

  • Crosslinking Studies:

    • Use chemical crosslinkers (DSS, BS3, or EDC) followed by mass spectrometry to identify interaction sites

    • Perform site-directed UV crosslinking by incorporating unnatural amino acids at suspected interaction interfaces

  • Biophysical Characterization:

    • Fluorescence resonance energy transfer (FRET) to monitor protein-protein interactions in real-time

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions protected upon complex formation

    • Native mass spectrometry to determine subcomplex stoichiometry and assembly intermediates

  • Structural Analysis:

    • Cryo-electron microscopy of reconstituted subcomplexes

    • X-ray crystallography of co-purified subunit b with interacting partners

    • NMR spectroscopy for analyzing dynamic interactions in solution

  • Functional Assays:

    • Site-directed mutagenesis of key residues followed by assembly assays

    • Deletion analysis of various domains to map interaction regions

Research on ATP synthase subunit interactions has demonstrated that ATP and Mg²⁺ are crucial for proper complex formation, as they induce conformational changes that facilitate subunit recognition and binding . When studying subunit b interactions, the concentration of these cofactors should be carefully controlled (typically maintained at 2 mM) to ensure physiologically relevant results.

How does the sequence and structure of Enterobacter atpF compare to homologs in other bacterial species?

Enterobacter atpF shows significant sequence conservation with homologs from other Enterobacteriaceae family members, while displaying species-specific adaptations that likely reflect evolutionary pressures and functional specialization. Comparative analysis reveals:

In Enterobacter species, the atpF product contains adaptations that may contribute to the bacterium's ability to survive in diverse environments, including association with plant hosts . Gene expression studies in Enterobacter sp. SA187 have shown that ATP synthase components are differentially regulated when the bacterium transitions from free-living to plant-associated states, suggesting that these adaptations play important roles in the bacterium's lifestyle transitions .

What structural domains of atpF are critical for ATP synthase assembly and function?

The atpF protein contains several critical structural domains that are essential for ATP synthase assembly and function. Based on research with related bacterial ATP synthases, the following domains are of particular importance:

Research on ATP synthase assembly has demonstrated that the b subunit is essential for the formation of functional F₁F₀ complexes. Studies on related bacterial ATP synthases show that the assembly of higher-order complexes follows a specific sequence, with the b subunit playing a crucial role in recruiting the F₁ sector to the membrane-embedded F₀ sector . Additionally, the presence of ATP and Mg²⁺ has been shown to be essential for proper complex formation, suggesting that these cofactors induce conformational changes in the subunits that facilitate correct assembly .

How do post-translational modifications affect the function of Enterobacter atpF?

Post-translational modifications (PTMs) of Enterobacter atpF can significantly impact protein structure, stability, and function. While specific PTMs of Enterobacter atpF have not been extensively characterized, research on ATP synthase subunits in related bacterial species suggests several important modifications:

  • Phosphorylation:

    • Serine/threonine phosphorylation may regulate assembly with other subunits

    • Phosphorylation sites are often located at subunit interfaces

    • May respond to changes in cellular energy status or environmental conditions

  • Acetylation:

    • N-terminal acetylation can affect protein stability and intermolecular interactions

    • Lysine acetylation might modulate the electrostatic interactions with the δ subunit

  • Oxidative Modifications:

    • Cysteine residues can undergo oxidation under stress conditions

    • May serve as redox sensors that modulate ATP synthase activity

    • Important in adaptation to oxidative stress environments

These modifications are particularly relevant for Enterobacter species that transition between different lifestyles, such as Enterobacter sp. SA187, which adapts to both free-living and plant-associated states . Gene expression studies have shown that when Enterobacter associates with plant roots, expression patterns of genes related to energy metabolism change significantly, suggesting regulatory mechanisms that may involve post-translational modifications .

The functional consequences of these PTMs include altered binding affinity to other subunits, changes in the structural rigidity of the peripheral stalk, and modified response to environmental stressors. Researchers investigating these modifications should employ phosphoproteomics, redox proteomics, and site-directed mutagenesis to identify and characterize specific modification sites and their functional significance.

What are common difficulties in expressing and purifying recombinant atpF, and how can they be addressed?

Researchers frequently encounter several challenges when expressing and purifying recombinant atpF protein. These difficulties and their respective solutions include:

  • Protein Insolubility and Inclusion Body Formation:

    • Challenge: The membrane-associated nature of atpF often leads to inclusion body formation.

    • Solution: Express at lower temperatures (16-20°C) with reduced inducer concentration. Alternative approaches include using specialized E. coli strains (C41/C43) designed for membrane protein expression or fusion tags (SUMO, MBP) to enhance solubility .

  • Low Expression Yield:

    • Challenge: atpF often expresses at low levels in recombinant systems.

    • Solution: Optimize codon usage for the expression host, use stronger promoters (T7), and enrich growth media with supplements like glucose or glycerol. Consider bicistonic expression with natural binding partners to stabilize the protein, similar to the approach used for γε subunits .

  • Protein Instability During Purification:

    • Challenge: The isolated b subunit may be unstable without other ATP synthase components.

    • Solution: Include stabilizing agents like ATP and Mg²⁺ (2 mM each) in all purification buffers, as these have been shown to significantly enhance stability of ATP synthase subunits . Add 10-15% glycerol and keep all solutions at 4°C throughout the purification process.

  • Inefficient Membrane Extraction:

    • Challenge: Poor extraction of atpF from the membrane fraction.

    • Solution: Test different detergents (DDM, CHAPS, Triton X-100) at various concentrations to optimize extraction. For particularly difficult cases, consider extracting with a combination of detergents or using stronger solubilization techniques with careful refolding protocols.

  • Protein Aggregation:

    • Challenge: Purified atpF tends to aggregate over time.

    • Solution: Optimize buffer conditions (pH 7.5-8.0, 150-300 mM NaCl), use stabilizing additives like arginine (50-100 mM), and prevent freeze-thaw cycles. Consider chemical crosslinking to stabilize dimeric forms if the native oligomeric state is important for your research.

Implementing these strategies can typically increase yield from <0.5 mg/L to 2-5 mg/L of culture with significantly improved purity and stability.

How can researchers overcome challenges in studying atpF interactions with other ATP synthase subunits?

Studying interactions between atpF and other ATP synthase subunits presents several methodological challenges. Here are effective strategies to address these difficulties:

  • Transient or Weak Interactions:

    • Challenge: Interactions between atpF and some subunits may be transient or of low affinity.

    • Solution: Use chemical crosslinking agents (DSS, formaldehyde) to capture transient interactions. Employ proximity-based labeling techniques like BioID or APEX2 to identify even weak interaction partners. Perform experiments in the presence of ATP/Mg²⁺ (2 mM), which have been demonstrated to stabilize ATP synthase subunit interactions .

  • Complex Assembly Intermediates:

    • Challenge: Difficulty in capturing assembly intermediates for structural studies.

    • Solution: Employ time-resolved analytical techniques like SEC-MALS, native MS, or LILBID-MS to monitor assembly pathways . Use strategic mutations that slow down but don't abolish assembly to trap intermediates. Temperature-sensitive variants can also be useful for this purpose.

  • Distinguishing Direct from Indirect Interactions:

    • Challenge: Determining whether atpF directly interacts with various subunits.

    • Solution: Use minimal reconstituted systems with purified components rather than complex mixtures. Apply techniques that specifically detect direct interactions, such as FRET with site-specific labels, ITC, or SPR. Validate with techniques like yeast two-hybrid or bacterial two-hybrid systems with appropriate controls.

  • Membrane Environment Requirements:

    • Challenge: Some interactions may depend on the membrane environment.

    • Solution: Reconstitute proteins into liposomes or nanodiscs to provide a native-like membrane environment. Use lipid compositions that mimic the bacterial inner membrane. For in vitro studies, consider using inverted membrane vesicles prepared from Enterobacter species, which maintain the native membrane environment .

  • Stoichiometry Determination:

    • Challenge: Accurately determining subunit stoichiometry in complexes.

    • Solution: Combine quantitative mass spectrometry approaches like LILBID-MS with analytical ultracentrifugation. These techniques have successfully determined the stoichiometry of bacterial ATP synthase subcomplexes . For membrane proteins, native mass spectrometry with appropriate detergent screening can provide accurate stoichiometric information.

By implementing these methodological approaches, researchers can overcome the inherent challenges in studying protein-protein interactions within the dynamic ATP synthase complex.

What are the best approaches for studying the effect of mutations in the atpF gene on ATP synthase function?

Investigating the functional consequences of atpF mutations requires a comprehensive experimental strategy. Based on research approaches used for other ATP synthase subunits, the following methodologies are recommended:

  • In Vitro Reconstitution Assays:

    • Express and purify wild-type and mutant atpF proteins using optimized protocols

    • Reconstitute with other purified subunits to form subcomplexes or complete ATP synthase

    • Assess complex formation using techniques like SEC, native PAGE, or LILBID-MS

    • Measure ATP synthesis/hydrolysis activities of the reconstituted complexes

  • Genetic Complementation Studies:

    • Generate an atpF knockout strain of Enterobacter (or E. coli as a model system)

    • Transform with plasmids expressing wild-type or mutant atpF variants

    • Assess growth phenotypes under various conditions (different carbon sources, stress conditions)

    • Measure cellular ATP levels and membrane potential to evaluate ATP synthase function

  • Structure-Based Analysis:

    • Use cryo-EM or X-ray crystallography to determine structural changes induced by mutations

    • Apply molecular dynamics simulations to predict effects on protein flexibility and interactions

    • Perform HDX-MS to identify altered dynamics and interaction interfaces

  • Bioenergetic Characterization:

    • Prepare inverted membrane vesicles from cells expressing wild-type or mutant atpF

    • Measure proton translocation efficiency using pH-sensitive fluorescent dyes

    • Quantify ATP synthesis rates under various conditions (pH gradients, ion concentrations)

    • Assess coupling efficiency between proton translocation and ATP synthesis/hydrolysis

When designing mutation studies, focus on:

  • Conserved residues identified through multiple sequence alignment

  • Interface residues that contact other subunits (particularly δ subunit interaction sites)

  • Regions implicated in dimerization

  • Transmembrane domain residues that may affect membrane anchoring

This multi-faceted approach allows for comprehensive characterization of how specific mutations impact atpF function within the context of the complete ATP synthase complex.

How does Enterobacter sp. atpF contribute to bacterial adaptation to different environments?

Enterobacter species occupy diverse ecological niches, from soil and water to plant and animal hosts, and the atpF subunit plays a critical role in this adaptability. Research on Enterobacter sp. SA187, an endophytic bacterium that promotes plant growth under abiotic stress conditions, provides valuable insights into this adaptation process .

Gene expression studies have revealed that ATP synthase components, including atpF, are differentially regulated when Enterobacter transitions from free-living to plant-associated states . When associated with plant roots, Enterobacter sp. SA187 shows altered expression of genes related to energy metabolism, suggesting that ATP synthase function is modulated as part of the adaptation process . Specifically, genes involved in iron acquisition (afuA), carotenoid synthesis (crtB), siderophore export (entS), and sucrose uptake (srcA) are upregulated, while flagellin genes (fliC) are downregulated, indicating a shift from motility to a sessile, energy-efficient lifestyle .

The atpF subunit, as a critical component of the ATP synthase complex, likely participates in this adaptation by:

  • Adjusting ATP synthesis efficiency to match energy requirements in different environments

  • Contributing to maintenance of proton motive force under varying pH and salt conditions

  • Potentially interacting with environment-specific regulatory factors

The unique structural features of Enterobacter atpF may enable specific adaptations to challenging environments, such as the ability of Enterobacter sp. SA187 to thrive in arid conditions and provide drought tolerance to host plants . Further research using comparative genomics, transcriptomics, and structure-function analyses will help elucidate the specific adaptations in atpF that contribute to Enterobacter's environmental versatility.

What is the potential for developing inhibitors targeting bacterial ATP synthase subunit b as antimicrobials?

The development of inhibitors targeting bacterial ATP synthase subunit b represents a promising approach for novel antimicrobials, particularly against drug-resistant Enterobacter species. Recent research on targeting mycobacterial ATP synthase provides a valuable framework for this approach .

The peripheral stalk, including subunit b, offers several advantages as an antimicrobial target:

  • Essential Function: Disruption of subunit b prevents proper assembly of the ATP synthase complex, which is crucial for bacterial energy metabolism.

  • Structural Uniqueness: Bacterial ATP synthase subunit b differs significantly from human mitochondrial ATP synthase, potentially allowing for selective targeting.

  • Accessible Interfaces: The interaction interfaces between subunit b and other components (particularly the δ subunit) present druggable pockets that could be targeted with small molecules.

A study targeting the C-terminal region of the mycobacterial ATP synthase α subunit, which interacts with the γ subunit, successfully identified inhibitors that disrupted this interaction and inhibited ATP synthesis . A similar approach could be applied to target the b-δ interface in Enterobacter ATP synthase.

Development strategies could include:

  • Structure-Based Drug Design: Using cryo-EM or crystallographic structures of the b-δ interface to design small molecules that disrupt this interaction

  • Peptide Mimetics: Developing peptides that mimic the binding region of subunit b or δ to competitively inhibit their interaction

  • High-Throughput Screening: Screening chemical libraries for compounds that bind to atpF and prevent its interaction with other subunits

Given the rise of multidrug-resistant Enterobacter strains in healthcare settings , developing such targeted inhibitors could provide valuable new therapeutic options. The different sequence and structural features of atpF compared to human ATP synthase components offer the potential for selective toxicity, making this a promising approach for antimicrobial development.

What are the most pressing unanswered questions regarding Enterobacter sp. atpF?

Despite significant advances in understanding bacterial ATP synthases, several critical questions regarding Enterobacter sp. atpF remain unanswered. These knowledge gaps represent important opportunities for future research:

  • Structural Adaptations: How do the specific sequence and structural features of Enterobacter atpF contribute to the bacterium's ability to thrive in diverse environments, including in association with plant hosts? Comparative structural biology approaches could help elucidate these adaptations .

  • Regulatory Mechanisms: What post-translational modifications and protein-protein interactions regulate atpF function in response to environmental changes? The differential gene expression patterns observed when Enterobacter associates with plant roots suggest complex regulatory mechanisms that remain to be fully characterized .

  • Assembly Pathways: What are the precise steps and energy requirements for integration of atpF into the ATP synthase complex in Enterobacter species? While general principles of ATP synthase assembly have been elucidated in model systems, species-specific variations may exist .

  • Role in Pathogenesis: How does atpF function contribute to the virulence and antimicrobial resistance of pathogenic Enterobacter strains? The emergence of multidrug-resistant Enterobacter hormaechei in healthcare settings highlights the importance of understanding energy metabolism in these pathogens .

  • Interaction Networks: What are the complete interaction networks of atpF beyond the ATP synthase complex? The possibility of moonlighting functions or interactions with other cellular systems remains unexplored.

Addressing these questions will require integrating advanced structural biology techniques, systems biology approaches, and focused biochemical studies to build a comprehensive understanding of this important protein in Enterobacter species.

What emerging technologies will advance research on bacterial ATP synthase subunit b?

Several cutting-edge technologies are poised to significantly advance our understanding of bacterial ATP synthase subunit b, including Enterobacter atpF:

  • Cryo-Electron Tomography: This technique can visualize ATP synthase complexes in their native membrane environment, providing insights into the spatial organization and interactions of atpF within the intact cell.

  • Single-Molecule FRET and Optical Tweezers: These approaches allow real-time monitoring of conformational changes and mechanical properties of the peripheral stalk during ATP synthesis or hydrolysis, revealing the dynamic role of subunit b.

  • Integrative Structural Biology: Combining cryo-EM, X-ray crystallography, NMR, and computational modeling to build complete atomic models of the ATP synthase complex in different functional states.

  • AlphaFold and Deep Learning Approaches: AI-based structure prediction can generate accurate models of atpF and its interactions, particularly valuable for species-specific variants that are challenging to study experimentally.

  • CRISPR-Based Genome Editing: Precise modification of the atpF gene in its native context allows direct assessment of structure-function relationships in vivo.

  • High-Resolution Mass Spectrometry: Advanced MS techniques enable identification of post-translational modifications and quantitative analysis of complex assembly intermediates with unprecedented sensitivity and accuracy .

  • Microfluidics and Single-Cell Analysis: These techniques can reveal cell-to-cell variability in ATP synthase composition and function under different environmental conditions, particularly relevant for Enterobacter species that transition between different lifestyles .

The integration of these technologies with traditional biochemical and genetic approaches will provide comprehensive insights into the structure, function, and regulation of bacterial ATP synthase subunit b, potentially leading to new antimicrobial strategies and biotechnological applications.

How might understanding atpF contribute to biotechnological applications beyond antimicrobial development?

Understanding Enterobacter sp. atpF has potential applications extending well beyond antimicrobial development, particularly in biotechnology, agriculture, and bioenergy:

  • Engineered Bioenergetic Systems: Knowledge of atpF structure and function could enable the design of modified ATP synthases with enhanced efficiency or novel regulatory properties for biotechnological applications.

  • Plant Growth Promotion: Enterobacter sp. SA187 has demonstrated remarkable abilities to promote plant growth under abiotic stress conditions . Understanding how ATP synthase components, including atpF, contribute to this beneficial plant-microbe interaction could lead to engineered probiotics for agricultural applications, particularly in arid regions.

  • Biosensors: The ATP synthase complex could be engineered as a sensitive biosensor for detecting environmental changes, with modifications to atpF potentially serving as the signal transduction component.

  • Bioenergy Applications: Optimized ATP synthases could improve the efficiency of biofuel production or bio-electricity generation in microbial fuel cells.

  • Protein Engineering Platforms: The well-defined structure and assembly process of ATP synthase makes it an excellent platform for protein engineering approaches, with atpF potentially serving as a scaffold for introducing novel functions or interactions.

  • Synthetic Biology Tools: The regulatory mechanisms controlling atpF expression and assembly could be harnessed as genetic switches or control elements in synthetic biology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.