Recombinant Enterobacter sp. Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Introduction

Cardiolipin (CL) is a unique anionic phospholipid found in the membranes of bacteria, plants, and animals, but not archaea . In bacteria, CL is synthesized by cardiolipin synthase (Cls), an enzyme that catalyzes the transfer of a phosphatidyl group from one phosphatidylglycerol (PG) molecule to another, producing CL and glycerol . Enterobacter species, like other bacteria, utilize Cls for CL synthesis, which is crucial for maintaining membrane structure and function . Recombinant Cls refers to the Cls enzyme produced through recombinant DNA technology, where the gene encoding Cls from a specific organism (Enterobacter sp. in this case) is expressed in a different host organism to produce large quantities of the enzyme for research or industrial purposes.

Function and Importance of Cardiolipin Synthase

Cls is essential for the synthesis of cardiolipin, a major component of bacterial membranes . Cardiolipin plays several critical roles:

  • Membrane Structure and Stability: CL stabilizes membrane protein complexes and maintains membrane architecture .

  • Energy Transduction: CL is involved in proton conductance across energy-transducing membranes, acting as a proton trap .

  • Stress Response: CL synthesis is affected by cell envelope stress response mechanisms, indicating its role in adaptation to environmental changes .

  • Virulence Modulation: In some bacteria, CL influences virulence, highlighting its importance in bacterial pathogenesis .

Types of Cardiolipin Synthases

There are at least two main types of cardiolipin synthases, which differ in their catalytic mechanisms and evolutionary origins:

  • Phospholipase D (PLD) Superfamily: This type of Cls, common in bacteria, catalyzes the reversible transfer of a phosphatidyl group from one PG molecule to another . An example is the T. brucei cardiolipin synthase (TbCLS) .

  • CDP-alcohol Phosphatidyltransferase Superfamily: Found in eukaryotes and some bacteria, this Cls uses cytidine diphosphate-diacylglycerol (CDP-DAG) as the donor of the phosphatidyl group, transferring it to a molecule of PG to form CL .

Enterobacter sp. Cls and its Role in Daptomycin Resistance

Daptomycin (DAP) is an antibiotic used to treat infections caused by Gram-positive bacteria. Resistance to daptomycin in enterococci has been linked to mutations in genes that alter the cell envelope stress response and changes in enzymes, including cardiolipin synthase .

  • Cls Mutations: Mutations in Cls have been observed in daptomycin-resistant isolates of Enterococcus faecium and Enterococcus faecalis . These mutations often occur in specific regions of the Cls primary sequence, such as the N-terminal transmembrane helical region, a short linker region, and a region proximal to the PLD1 catalytic site .

  • Biochemical Characterization: Studies have shown that certain Cls mutations associated with daptomycin resistance can increase Cls activity (Vmax), suggesting that altered CL synthesis contributes to the resistance mechanism .

  • Association with Membrane: Cls enzymes are tightly associated with the membrane and copurify with their substrate, phosphatidylglycerol (PG), and product, cardiolipin (CL) . This suggests that Cls localizes to PG-rich membrane regions.

Recombinant Production and Study of Enterobacter sp. Cls

Producing recombinant Enterobacter sp. Cls allows researchers to study its biochemical properties,mutations, and role in CL synthesis and daptomycin resistance.

  • Expression and Purification: Recombinant Cls enzymes can be expressed in various host organisms and purified for in vitro studies . For example, Cls enzymes from Enterococcus faecium and Enterococcus faecalis have been expressed, purified, and characterized to understand the impact of daptomycin-resistance mutations on enzyme activity .

  • In vitro Assays: In vitro assays using purified recombinant Cls can determine kinetic parameters such as Vmax and Km, providing insights into how mutations affect enzyme function .

  • Complementation Studies: Recombinant Cls can be used in complementation studies to assess its ability to restore CL production in CL-deficient strains . For example, expressing Streptomyces coelicolor Cls in a CL-deficient Rhizobium etli mutant restored CL formation, demonstrating its function .

Table: Examples of Cls Studies and Findings

OrganismCls TypeKey FindingsReference
Escherichia coliPLD SuperfamilyDisruption of the cls gene reduces cardiolipin synthase activity, but the strains can still grow .
Streptomyces coelicolorCDP-alcohol PhosphatidyltransferaseExpression of Sco1389 in a CL-deficient Rhizobium etli mutant restores CL formation .
Enterococcus faecium/faecalisPLD SuperfamilyCls mutations associated with daptomycin resistance increase Cls activity .
Trypanosoma bruceiPLD SuperfamilyT. brucei cardiolipin synthase (TbCLS) complemented cardiolipin production in CRD1 knockout yeast .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
clsA; cls; Ent638_2295; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
clsA
Target Protein Sequence
MTTFYTVVSWLVILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERARAMWPSTAKWLNDLKSCKHIFAEENSSVASSLFKLCERRQGIAGVKGNQ LQLLTTSEDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAASRRGIHCRLMLD SAGSVAFFRSPWAGMMRNAGIEVVEALKVNLLRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRFFKQDSGVGQWIDLMARMEGPVATAMGIVYSCDWEIETGKRILPPPPDANIMPF EQESGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIMPRKNDSVLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDAGFGGDLAAVQDDYISRSRLLDASLWVKRPLWQRITERLFY FFSPLL
Uniprot No.

Target Background

Function

This enzyme catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase and what is its role in Enterobacter species?

Cardiolipin synthase (cls) is a membrane-associated enzyme that catalyzes the final step in cardiolipin biosynthesis. In Enterobacter species and related Enterobacteriaceae, cardiolipin synthase belongs to the phospholipase D (PLD) superfamily, characterized by conserved HKD motifs with a canonical spacing of HxK(x)4D in the active site .

The primary function of cardiolipin synthase is to synthesize cardiolipin (CL), a unique anionic phospholipid with four acyl chains connected by a small glycerol head group. This conical-shaped phospholipid comprises approximately 5-15% of bacterial membrane phospholipids, depending on growth phase and culture conditions . In Enterobacter species, cardiolipin contributes to membrane stability, proper cell division, and supports the function of respiratory complexes in the inner membrane .

How many types of cardiolipin synthases are present in Enterobacter species?

Based on research in closely related Enterobacteriaceae like E. coli, Enterobacter species likely possess three distinct cardiolipin synthases:

EnzymeGeneSubstrate SpecificityPrimary Expression Condition
ClsAclsAPG + PG → CL + GAll growth phases, particularly logarithmic growth at low osmolarity
ClsBclsB/ybhOPG + PG → CL + GStationary phase
ClsCclsC/ymdCPG + PE → CL + EAStationary phase (requires YmdB coexpression)

Where PG = phosphatidylglycerol, PE = phosphatidylethanolamine, CL = cardiolipin, G = glycerol, EA = ethanolamine .

The ymdB-clsC operon is specifically noted to be present in a group of bacteria closely related to E. coli, including Enterobacter species . Triple deletion of all three cls genes results in complete depletion of cardiolipin, confirming these are likely the only cardiolipin synthases in Enterobacteriaceae .

How does cardiolipin contribute to Enterobacter physiology and pathogenesis?

Cardiolipin plays several critical roles in Enterobacter physiology:

  • Membrane architecture: The conical shape of cardiolipin allows it to accumulate at membrane regions with negative curvature, especially at bacterial poles .

  • Electron transport: Cardiolipin interacts with and stabilizes respiratory chain protein complexes in the inner membrane, supporting efficient energy metabolism .

  • Stress response: Cardiolipin synthesis increases under osmotic stress conditions and in stationary phase, suggesting a role in stress adaptation .

  • Virulence: Although not directly studied in Enterobacter, research in related pathogens like Shigella shows that cardiolipin synthesis is required for proper intracellular division and spread to adjacent cells during infection .

  • Advanced Research Questions on Recombinant cls

What are the structural characteristics of Enterobacter cardiolipin synthase enzymes?

Enterobacter cardiolipin synthases share key structural features with those of related Enterobacteriaceae:

  • Domain organization: ClsA typically contains two putative transmembrane helices at the N-terminus, followed by two phospholipase D (PLD) domains containing conserved HKD motifs .

  • Active site configuration: The active site is likely formed by functional groups contributed from both PLD1 and PLD2 domains, with a histidine residue (equivalent to H217 in Enterococcus faecium) serving as the putative active-site nucleophile .

  • Membrane association: While ClsA contains transmembrane domains, ClsB and ClsC lack predicted transmembrane helices but still associate with the membrane, suggesting they are peripheral membrane proteins .

  • Substrate binding pockets: The enzymes have distinct substrate binding preferences, with ClsA and ClsB using two PG molecules, while ClsC uses PG and PE as substrates .

Mutation of the putative catalytic motif in ClsC prevents cardiolipin formation, confirming the essential role of the HKD motif in the catalytic mechanism .

What experimental approaches are used to measure cardiolipin synthase activity?

Several methodological approaches are used to assess cardiolipin synthase activity:

  • In vitro enzymatic assays:

    • Using purified recombinant cls enzymes with appropriate substrates (PG or PG+PE)

    • Measuring product formation (CL) using thin-layer chromatography (TLC) or mass spectrometry

    • Determining kinetic parameters (Vmax, Km) through time-course and substrate concentration variation experiments

  • In vivo cardiolipin quantification:

    • Bligh-Dyer phospholipid extraction from bacterial cultures

    • Separation by thin-layer chromatography for visualization and quantification

    • Comparing cls mutants to wild-type strains under various growth conditions

  • Activity validation in genetic complementation studies:

    • Expressing recombinant cls in cls-knockout strains

    • Assessing restoration of cardiolipin levels

    • Testing phenotypic recovery (growth, stress resistance)

For example, in studies of E. faecium Cls447a and variants, activity was measured as μM CL/min/μM protein, with wild-type showing 0.16 ± 0.01 compared to 0.26 ± 0.02 and 0.26 ± 0.04 for Cls447a H215R and Cls447a R218Q mutants, respectively .

How do mutations in cardiolipin synthase affect bacterial antibiotic resistance?

Mutations in cardiolipin synthase have been linked to antibiotic resistance, particularly to daptomycin (DAP) in Enterococcus species. These findings provide insights that may be relevant to Enterobacter:

  • Increased enzymatic activity: Mutations in E. faecium Cls (H215R and R218Q) associated with DAP resistance showed approximately 60% higher enzymatic activity (Vmax) compared to the wild-type enzyme .

  • Structure-function relationship: These mutations are located proximal to the phospholipase domain 1 (PLD1) active site and near the putative nucleophile H217 .

  • Epistatic effects: Cls mutations appear to work in concert with other adaptive changes, particularly in the LiaFSR cell envelope stress response pathway, suggesting complex adaptive mechanisms .

  • Membrane composition alterations: Mutations in Cls can alter membrane phospholipid composition, potentially affecting drug-membrane interactions and reducing antibiotic efficacy .

  • Methodological Approaches for Recombinant Cls Production

What expression systems are optimal for producing recombinant Enterobacter cardiolipin synthase?

Several expression systems have been successfully used for recombinant cardiolipin synthase production, each with advantages for different research purposes:

Expression SystemAdvantagesConsiderationsExamples
E. coliHigh yield, ease of use, cost-effectiveMay require optimization for membrane protein expressionSuccessfully used for E. faecium Cls447a and E. faecalis Cls613a
YeastEukaryotic processing, higher folding fidelityLower yields than bacterial systemsAvailable for specialized applications
BaculovirusHigher expression of complex proteinsMore complex, time-consumingOptional for difficult-to-express variants
Mammalian cellsSuperior post-translational modificationsMost complex, expensiveUsed for specialized structural studies

When expressing cardiolipin synthase, several key considerations should be addressed:

  • Construct design:

    • For improved solubility and expression, truncated constructs excluding transmembrane domains have been successful (e.g., residues 52-482 of E. faecium Cls447a)

    • Addition of purification tags (His-tag) facilitates downstream purification

  • Expression conditions:

    • Temperature optimization (often lower temperatures improve folding)

    • Induction parameters (IPTG concentration, induction time)

    • Media composition and growth conditions

  • Toxicity management:

    • ClsA and ClsC overexpression can be toxic to cells

    • Use of tightly controlled inducible promoters with low induction levels may be necessary

What purification strategies yield functional recombinant cardiolipin synthase?

Based on successful purification of cardiolipin synthases from related species, the following purification strategy has proven effective:

  • Cell lysis:

    • Mechanical disruption (sonication or French press)

    • Buffer conditions: Typically containing 50 mM Tris (pH 8.0), 300 mM NaCl, 0.2 mM PMSF, 20% glycerol, and reducing agents like BME

  • Initial clarification:

    • Centrifugation at high speed (e.g., 34,000 rpm for 60 min at 4°C)

    • Collection of supernatant containing soluble protein

  • Affinity chromatography:

    • HiTrap affinity (Ni2+) column for His-tagged constructs

    • Washing with buffer containing low imidazole

    • Elution with step gradient to 500 mM imidazole

  • Secondary purification:

    • Ion exchange chromatography (e.g., HiTrap Q-XL Sepharose)

    • Equilibration in 20 mM Tris, pH 8.5, 100 mM NaCl

    • Elution with linear gradient of 0.1 to 1 M NaCl

  • Final polishing (if needed):

    • Size exclusion chromatography

    • Concentration and storage in appropriate buffer with glycerol

Important considerations:

  • Cardiolipin synthases typically copurify with their substrate (PG) and product (CL)

  • The enzyme localizes to PG-rich membrane regions

  • Detergent may be needed for solubilization and stability

How can the activity and structure of recombinant cardiolipin synthase be characterized?

Multiple complementary approaches can be employed to characterize recombinant cardiolipin synthase:

  • Enzymatic activity assays:

    • Steady-state kinetics measuring product formation rates

    • Substrate specificity determination using various phospholipid substrates

    • pH and temperature optima determination

  • Structural characterization:

    • Protein modeling based on homologous structures (e.g., Streptomyces sp. phospholipase D)

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for protein complexes

    • Circular dichroism for secondary structure analysis

  • Protein-membrane interaction studies:

    • Analysis of enzyme association with specific lipid domains

    • Determination of membrane binding properties

    • Assessment of protein-lipid interactions

  • Complex formation analysis:

    • Blue-native gel electrophoresis to identify protein complexes

    • Immunofluorescence microscopy to determine subcellular localization

    • Co-immunoprecipitation to identify interacting partners

  • Functional complementation:

    • Expression in cls knockout strains

    • Assessment of cardiolipin restoration

    • Phenotypic characterization under various stress conditions

For example, modeling of E. faecium Cls447a to Streptomyces sp. phospholipase D has helped identify that adaptive mutations (H215R and R218Q) are located proximal to the active site domain .

  • Research Applications and Future Directions

How can recombinant cardiolipin synthase be used to study antimicrobial resistance mechanisms?

Recombinant cardiolipin synthase provides powerful tools for investigating antimicrobial resistance:

  • Structure-function studies:

    • Site-directed mutagenesis of key residues identified in resistant isolates

    • Biochemical characterization of mutant enzymes

    • Correlation of enzymatic parameters with resistance phenotypes

  • Membrane composition analysis:

    • Evaluation of how cls mutations alter membrane phospholipid profiles

    • Assessment of changes in membrane properties (fluidity, charge, permeability)

    • Correlation with antibiotic susceptibility

  • Drug-target interaction studies:

    • Investigation of direct interactions between antibiotics and membrane lipids

    • Evaluation of how cls mutations alter these interactions

    • Development of models for resistance mechanisms

  • Systems biology approaches:

    • Integration of cls function with other resistance mechanisms

    • Network analysis of epistatic interactions

    • Identification of potential combination therapy targets

Current research suggests that cls mutations are part of a larger genomic adaptation process and are highly epistatic with other changes to facilitate resistance, particularly to membrane-active antibiotics like daptomycin .

What are the comparative differences between cardiolipin synthases across bacterial species?

Cardiolipin synthases show notable differences across bacterial species:

FeatureEnterobacteriaceaeEnterococcusOther Bacteria
Number of cls genesThree (clsA, clsB, clsC) One predominant cls Varies by species
Substrate specificityClsA/B: PG+PG
ClsC: PG+PE
PG+PG Species-dependent
Expression patternsGrowth phase and condition-dependent Constitutive with regulated activity Species-dependent
Role in antibiotic resistanceLimited dataDirect link to daptomycin resistance Varies by species and antibiotic
Catalytic mechanismPhospholipase D-type Phospholipase D-type Generally conserved

Interestingly, while eukaryotic cardiolipin synthases typically belong to the CDP-alcohol phosphatidyl transferase family, some eukaryotic organisms like Trypanosoma brucei possess a bacterial-type cardiolipin synthase with a prokaryotic-type CLS active site domain . This highlights the evolutionary diversity of these enzymes.

Cross-species complementation studies have shown that T. brucei CLS can complement cardiolipin production in CRD1 knockout yeast, demonstrating functional conservation despite mechanistic differences .

What new research directions are emerging in cardiolipin synthase biology?

Several promising research directions are emerging in cardiolipin synthase biology:

  • Structural biology advancements:

    • High-resolution structures of cardiolipin synthases

    • Dynamics of membrane association and substrate binding

    • Mechanistic insights into catalysis

  • Systems-level understanding:

    • Integration of cardiolipin synthesis with other membrane biogenesis pathways

    • Regulatory networks controlling cls expression

    • Spatial organization of cardiolipin synthesis machinery

  • Therapeutic targeting:

    • Development of specific cls inhibitors

    • Combination therapies targeting cls and other resistance mechanisms

    • Structure-based drug design approaches

  • Cross-species complementation:

    • Further studies on functional conservation across prokaryotic and eukaryotic cls enzymes

    • Investigation of why E. coli and related bacteria maintain multiple cls genes with different mechanisms

  • Pathogenesis mechanisms:

    • Role of cardiolipin in virulence factor production and function

    • Impact on host-pathogen interactions

    • Contribution to biofilm formation and persistence

The discovery that cardiolipin synthesis and remodeling may be tightly coupled processes requiring clustering of involved proteins into specific CL-synthesizing domains provides an intriguing new avenue for research into the spatial organization of membrane lipid synthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.