Recombinant Enterobacter sp. Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Enterobacter sp. Fumarate Reductase Subunit D (frdD)

Recombinant Enterobacter sp. fumarate reductase subunit D (frdD) is a hydrophobic protein component of the bacterial fumarate reductase complex, expressed in Escherichia coli for research and diagnostic applications. This subunit plays a critical role in membrane anchoring and electron transfer within the enzyme complex, enabling anaerobic respiration by reducing fumarate to succinate .

Biochemical Characteristics of frdD

PropertyDetailsSource
Molecular Weight~13 kDa (partial recombinant fragment)
SequencePartial sequence: MINPNPKRSDEPVFWGLFGAGGMWSAIVAPVIILLVAILLPLGLFPGEALGYERVLAFAS SFIGRVFIFLMIVLPLWLGLHRIHHAMHDLKIHVPNGKWVFYGLATILTVVTLVAIVTI
Purity>85% (SDS-PAGE verified)
Storage BufferTris-based buffer with 50% glycerol (pH unspecified)
Stability-20°C/-80°C (long-term); 4°C (working aliquots, ≤1 week)

Production and Purification of frdD

The recombinant protein is produced via bacterial expression in E. coli, leveraging the strain’s robust protein synthesis machinery. Key steps include:

  • Expression: Cloning of the frdD gene into a plasmid vector under an inducible promoter.

  • Purification: Likely involves affinity chromatography (e.g., His-tag) followed by gel filtration for size exclusion .

  • Quality Control: SDS-PAGE analysis confirms >85% purity, with no mention of post-translational modifications .

Functional Role in Fumarate Reductase

FrdD is part of a heterotetrameric complex (FrdABCD) that catalyzes fumarate reduction using reduced quinones as electron donors. Key functional insights include:

  • Membrane Anchoring: FrdD and FrdC subunits facilitate membrane association, enabling interaction with quinone electron carriers .

  • Electron Transfer: The hydrophobic nature of FrdD suggests involvement in stabilizing the electron transport chain within the complex .

  • Species-Specific Context: In Enterobacter, FrdD’s role mirrors that of analogous subunits in E. coli (e.g., FrdD in E. coli is essential for quinone oxidation and enzyme assembly) .

Applications in Research and Diagnostics

ApplicationDescriptionExample Use Cases
ELISA DevelopmentServes as an antigen for detecting anti-fumarate reductase antibodies.Pathogen identification, vaccine studies
Enzyme Kinetics StudiesUsed to investigate electron transfer mechanisms in anaerobic respiration.Biochemical assays with NADH/fumarate
Structural BiologyProvides material for X-ray crystallography or cryo-EM studies of the complexMembrane protein interaction analysis

Comparative Analysis with Homologous Subunits

OrganismFumarate Reductase SubunitKey DistinctionsReference
Enterobacter sp. (strain 638)FrdD13 kDa hydrophobic protein; partial recombinant
Escherichia coliFrdDFull-length protein; required for membrane association
Geobacter sulfurreducensFrdC (membrane anchor)Contains transmembrane helices; binds b-type hemes

Research Challenges and Future Directions

  • Functional Elucidation: Limited studies directly address frdD’s specific role in Enterobacter. Comparative genomics with E. coli models may provide insights.

  • Structural Determination: Full-length frdD crystals or cryo-EM structures are needed to resolve its interaction with FrdC and the catalytic subunits.

  • Therapeutic Targeting: FrdD’s role in pathogen metabolism (e.g., Actinobacillus pleuropneumoniae) highlights its potential as an antimicrobial target .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
frdD; Ent638_0340; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIVAPVIILLVAILLPLGLFPGEALGYERVLAFAS SFIGRVFIFLMIVLPLWLGLHRIHHAMHDLKIHVPNGKWVFYGLATILTVVTLVAIVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit D anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is fumarate reductase and what specific role does subunit D play in its functionality?

Fumarate reductase (FRD) is an enzyme that catalyzes the reduction of fumarate to succinate, playing a critical role in anaerobic respiration for many bacteria. While this reaction represents the reverse of that catalyzed by succinate dehydrogenase (SDH) in the tricarboxylic acid cycle, FRD operates primarily under anaerobic conditions where fumarate serves as a terminal electron acceptor . In Enterobacteriaceae including Enterobacter species, fumarate reductase typically consists of four subunits (FRD A, B, C, and D).

Fumarate reductase subunit D (frdD) is a small hydrophobic protein (approximately 13 kDa) that serves as an essential membrane anchor component of the enzyme complex . The specific function of frdD involves:

  • Facilitating proper membrane association of the entire fumarate reductase complex

  • Enabling interaction with quinone-based electron donors

  • Supporting the structural integrity required for enzyme activity

  • Contributing to the assembly of a functional enzyme complex

Research has demonstrated that frdD, along with FRD C, is required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues, highlighting its critical role in electron transport chain functionality .

How does subunit D interact with other fumarate reductase subunits to form a functional complex?

The interaction between frdD and other fumarate reductase subunits follows a specific assembly pattern that is critical for enzyme functionality. The functional assembly depends on:

  • Subunit complementarity: Research has shown that all four fumarate reductase subunits must be present for the restoration of anaerobic growth in bacterial strains lacking the chromosomal frd operon .

  • Dimer formation: The FRD A and FRD B subunits form a catalytically active dimer that can catalyze the benzyl viologen oxidase reaction, though neither subunit alone can perform this function .

  • Membrane anchoring: Both FRD C and FRD D subunits are required together for proper membrane association of the entire complex and for the oxidation of reduced quinone analogues .

  • Genetic proximity requirement: Studies have demonstrated that separation of the DNA coding for FRD C and FRD D proteins affects the ability of fumarate reductase to assemble into a functional complex. When the frdABC and frdD genes were introduced on two separate plasmid vectors, this failed to restore anaerobic growth on glycerol and fumarate, indicating that genetic proximity may influence proper protein interaction and complex assembly .

These findings highlight the intricate interdependence of all four subunits and suggest that the spatial arrangement of genes within the frd operon has been evolutionarily optimized to ensure proper complex assembly.

What methodologies are most effective for expressing and purifying recombinant frdD for structural and functional studies?

Successful expression and purification of recombinant frdD requires specialized techniques due to its hydrophobic nature and membrane-associated characteristics. Based on current research practices, the following methodological approach is recommended:

Expression System Selection:

  • E. coli BL21(DE3) or similar expression hosts are typically preferred due to their reduced protease activity

  • Expression vectors containing T7 promoters allow for controlled induction

  • Fusion tags (such as His6, MBP, or SUMO) can enhance solubility and facilitate purification

Optimal Expression Conditions:

  • Induction at lower temperatures (16-20°C) reduces inclusion body formation

  • Use of specialized media containing glycerol can improve membrane protein expression

  • Addition of specific detergents (0.1-0.5% n-dodecyl-β-D-maltoside or Triton X-100) during cell lysis helps solubilize the membrane-associated protein

Purification Protocol:

  • Cell lysis under native conditions with appropriate detergents

  • Affinity chromatography using the fusion tag (e.g., Ni-NTA for His-tagged proteins)

  • Size-exclusion chromatography for further purification

  • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

Critical Considerations:

  • Avoid repeated freeze-thaw cycles as these can denature membrane proteins

  • For working solutions, store aliquots at 4°C for up to one week

  • The specific tag type may need to be determined during the production process to optimize for each preparation

This methodological approach provides a framework for researchers to obtain pure, functional recombinant frdD suitable for subsequent structural and functional analyses.

How do mutations in frdD impact antimicrobial resistance mechanisms in Enterobacteriaceae?

Mutations in the frdD gene have significant implications for antimicrobial resistance development in Enterobacteriaceae, particularly through multiple interconnected mechanisms:

  • Relationship with the ampC promoter: The frd operon contains the promoter of the ampC beta-lactamase gene, establishing a direct genetic link between fumarate reductase functionality and beta-lactam resistance . Mutations in frdD can potentially affect ampC expression, altering resistance profiles.

  • Adaptive responses to antibiotic exposure: Recent research has identified mutations in frdD arising during adaptation to amoxicillin exposure in Escherichia coli, suggesting a role in adaptive resistance mechanisms .

  • Metabolic compensation: Alterations in frdD may modify cellular metabolism under antibiotic stress conditions, potentially contributing to bacterial persistence during antimicrobial therapy.

  • Membrane permeability effects: As a membrane-associated protein, changes in frdD structure or expression can influence membrane composition and permeability, potentially affecting the uptake of antibiotics.

The table below summarizes key findings regarding frdD mutations and their impacts on antimicrobial resistance:

AntibioticObserved frdD MutationsResistance MechanismResearch Model
AmoxicillinMutations in frdD identified in evolved strainsPossible alteration of ampC expressionE. coli adaptation study
β-lactamsfrdD mutations associated with ampC promoter alterationsModified expression of beta-lactamaseClinical Enterobacteriaceae isolates
Multiple antibioticsChanges in frdD expression during stress responseMetabolic adaptation enabling persistenceTranscriptomic analyses of resistant strains

These findings indicate that frdD plays a more complex role in antimicrobial resistance than previously recognized, extending beyond its primary metabolic function to potential regulatory effects on resistance determinants.

What techniques are used to study the membrane association properties of frdD and their impact on enzyme activity?

Investigating the membrane association properties of frdD and its impact on fumarate reductase activity requires specialized techniques that can probe both structural associations and functional consequences. Current research employs the following methodological approaches:

1. Membrane Fractionation Studies:

  • Differential centrifugation to separate membrane-associated and cytosolic fractions

  • Western blot analysis with antibodies specific to frdD to quantify membrane localization

  • Comparison of wild-type and mutant frdD localization patterns to identify critical residues

2. Site-Directed Mutagenesis Approaches:

  • Targeted modification of hydrophobic domains to assess their role in membrane association

  • Creation of chimeric proteins to identify specific membrane-binding motifs

  • Expression of truncated frdD variants to define minimal functional domains

3. Enzyme Activity Assays:

  • Benzyl viologen oxidase assay to assess electron transfer capabilities

  • Measurement of fumarate reduction using NADH or other electron donors

  • Quinone oxidation assays to evaluate electron transport from reduced quinone analogues

4. Reconstitution Experiments:

  • In vivo complementation studies using E. coli strains lacking chromosomal frd operon

  • Testing different combinations of fumarate reductase subunits to determine minimal functional units

  • Analysis of growth under anaerobic conditions with glycerol and fumarate as indicators of functional enzyme assembly

5. Biophysical Characterization:

  • Circular dichroism spectroscopy to analyze secondary structure

  • Fluorescence resonance energy transfer (FRET) to study protein-protein interactions within the membrane

  • Electron microscopy to visualize membrane-protein complexes

Research has demonstrated that both FRD C and FRD D are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues, highlighting the essential nature of these membrane-anchoring subunits . Furthermore, the spatial arrangement of genes encoding these subunits appears critical, as separation of frdC and frdD genes on different plasmids prevents the formation of functional complexes, suggesting specific assembly requirements .

How conserved is frdD across different Enterobacteriaceae and what does this suggest about its evolutionary importance?

The conservation pattern of frdD across Enterobacteriaceae provides valuable insights into its evolutionary significance and functional constraints. Analysis of genomic and proteomic data reveals several key patterns:

Conservation Patterns:

  • The core structural features of frdD, particularly its hydrophobic transmembrane domains, show high conservation across Enterobacteriaceae, reflecting evolutionary constraints on membrane-anchoring functionality

  • Specific amino acid residues involved in interactions with other fumarate reductase subunits demonstrate greater conservation than peripheral regions

  • The genetic organization of the frd operon, with frdD positioned downstream of frdC, is highly conserved, supporting the finding that this spatial arrangement is critical for proper complex assembly

The conservation of frdD has important evolutionary implications. The requirement for all four fumarate reductase subunits for anaerobic growth on glycerol and fumarate suggests strong selection pressure to maintain the complete enzyme complex . Furthermore, the genetic linkage between the frd operon and antimicrobial resistance genes, such as ampC, indicates potential co-evolutionary processes between metabolic functions and adaptive responses to environmental stressors .

Interestingly, while membrane-bound fumarate reductases are common in many organisms, there are also examples of soluble NADH-dependent fumarate reductases in certain species, such as the thermophilic bacterium Methanothermobacter thermoautotrophicus . This diversity suggests that different evolutionary solutions have emerged for fumarate reduction across microbial lineages, potentially reflecting adaptations to specific ecological niches.

How do membrane-bound versus soluble fumarate reductases differ in structure, function, and distribution across bacterial species?

The distinction between membrane-bound and soluble fumarate reductases represents a fundamental divergence in enzymatic strategy across bacterial species, with significant implications for metabolism, electron transport, and ecological adaptation:

Structural Comparison:

FeatureMembrane-Bound FRD (e.g., Enterobacter)Soluble FRD (e.g., M. thermoautotrophicus)
Subunit CompositionFour subunits (FRD A, B, C, D) Two subunits (homologous to FrdA and FrdB)
Membrane AssociationAnchored via hydrophobic subunits C and D Cytoplasmic localization
Electron DonorTypically quinol or similar membrane-associated donors NADH (does not react with NADPH)
Genetic OrganizationComplete frd operon with all subunits in proximity Simplified genetic structure

Functional Differences:

Membrane-bound fumarate reductases in Enterobacteriaceae function primarily in anaerobic respiration, where fumarate serves as a terminal electron acceptor. The electron transport chain involves quinones embedded in the membrane, with FRD C and FRD D subunits facilitating electron transfer from these quinones to the catalytic FRD A and B subunits .

In contrast, soluble fumarate reductases, such as the one characterized in Methanothermobacter thermoautotrophicus, utilize NADH as an electron donor and function in the reductive tricarboxylic acid cycle. This enzyme shows specificity for NADH and does not react with NADPH, displaying a Km value for NADH of approximately 42 μM .

Phylogenetic and Ecological Distribution:

The distribution of these different types of fumarate reductases appears to correlate with ecological niches and metabolic strategies:

  • Membrane-bound FRDs are prevalent in facultative anaerobes like Enterobacteriaceae, which must transition between aerobic and anaerobic metabolism

  • Soluble FRDs are more common in strict anaerobes and certain thermophilic species

  • The presence of different types may reflect adaptation to specific environmental conditions, particularly oxygen availability and temperature

This diversity in fumarate reductase structure and function demonstrates the evolutionary plasticity of this important metabolic enzyme, highlighting how different solutions have evolved to accomplish similar biochemical reactions across diverse bacterial lineages.

What are the optimal assay conditions for measuring fumarate reductase activity in recombinant systems expressing frdD?

Accurate measurement of fumarate reductase activity in recombinant systems expressing frdD requires carefully optimized assay conditions that account for the enzyme's biochemical properties and the specific characteristics of the recombinant system. Based on established research methodologies, the following protocol provides a comprehensive approach:

Standard Reaction Mixture Components:

  • Buffer system: 50 mM NaPO₄ (pH 6.5) for optimal activity

  • Substrate: 5-20 mM fumarate (concentration can be varied for kinetic studies)

  • Electron donor: 0.2-0.5 mM NADH for soluble systems or appropriate quinol derivatives for membrane-bound systems

  • Alternative electron donors that can be tested: reduced methyl viologen (5 mM), benzyl viologen (10 mM), FADH₂ (0.25 mM), or FMNH₂ (0.25 mM)

Assay Conditions:

  • Temperature: 37°C for mesophilic bacteria or 70°C for thermophilic species

  • Atmosphere: Maintain anaerobic conditions (Ar gas phase recommended)

  • Total reaction volume: 200-500 μL

  • Preincubation time: 5 minutes before initiating the reaction

Measurement Methods:

  • Spectrophotometric monitoring of NADH oxidation:

    • Track decrease in absorbance at 340 nm

    • Calculate activity using extinction coefficient of 6.2 mM⁻¹ cm⁻¹

  • Direct measurement of succinate production:

    • High-performance liquid chromatography (HPLC)

    • Gas chromatography-mass spectrometry (GC-MS)

    • Nuclear magnetic resonance (NMR) for detailed product analysis

Kinetic Parameter Determination:

  • For Km determination for fumarate: Test concentrations ranging from 0.01 to 20 mM

  • For Km determination for NADH: Test concentrations ranging from 0.03 to 0.2 mM

  • Calculate kinetic parameters using appropriate enzyme kinetics software

Controls and Validations:

  • Negative control: Reaction mixture without enzyme

  • Positive control: Commercially available fumarate reductase

  • Substrate specificity control: Replace fumarate with other dicarboxylic acids

This methodological approach provides a robust framework for measuring fumarate reductase activity in recombinant systems and can be adapted based on the specific research questions and available equipment.

How can researchers effectively design experiments to study the interaction between frdD and other subunits of the fumarate reductase complex?

Designing effective experiments to investigate the interactions between frdD and other fumarate reductase subunits requires a multi-faceted approach combining genetic, biochemical, and biophysical techniques. The following experimental design framework addresses this complex research question:

1. Genetic Complementation Studies:

This approach uses strains lacking chromosomal frd genes to test functional interactions:

  • Use E. coli strain MI1443 (or equivalent) that lacks the chromosomal frd operon and cannot grow anaerobically on glycerol and fumarate

  • Create plasmid constructs expressing different combinations of FRD subunits:

    • Complete frd operon (positive control)

    • Individual subunits (frdA, frdB, frdC, frdD)

    • Partial combinations (frdA+frdB, frdC+frdD, frdAB+frdCD, etc.)

    • Constructs with spatial separation of genes (frdABC on one plasmid, frdD on another)

  • Evaluate anaerobic growth on glycerol and fumarate to assess functional complementation

  • Measure enzyme activity using the benzyl viologen oxidase assay

2. Protein-Protein Interaction Analysis:

These techniques directly investigate physical interactions between subunits:

  • Co-immunoprecipitation with antibodies specific to individual FRD subunits

  • Bacterial two-hybrid system to screen for interaction partners

  • Cross-linking studies followed by mass spectrometry to identify interaction surfaces

  • Surface plasmon resonance to quantify binding affinities between purified subunits

3. Structural Biology Approaches:

These methods provide detailed information about complex assembly:

  • Cryo-electron microscopy of the intact complex

  • X-ray crystallography of the assembled complex or subcomplexes

  • NMR spectroscopy for smaller subunit-subunit interfaces

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

4. Site-Directed Mutagenesis Strategy:

This approach identifies specific residues critical for subunit interactions:

  • Create a library of frdD mutants with alterations in potential interaction domains

  • Express mutants in complementation systems and assess functional impact

  • Combine with structural data to map interaction networks

  • Create chimeric proteins by swapping domains between different species' frdD to identify functional interaction motifs

5. Experimental Validation Protocol:

Experimental QuestionPrimary TechniqueSecondary ValidationExpected Outcome
Is frdD essential for complex function?Genetic complementationEnzyme activity assaysGrowth restoration only with frdD present
Which domains of frdD interact with frdC?Site-directed mutagenesisCo-immunoprecipitationIdentification of critical interaction residues
How does membrane association depend on frdD?Subcellular fractionationFluorescence microscopyQuantification of membrane localization
What is the stoichiometry of the complex?Analytical ultracentrifugationNative mass spectrometryDetermination of subunit ratios

These methodological approaches collectively provide a comprehensive strategy for investigating the complex interactions between frdD and other fumarate reductase subunits, enabling researchers to develop a detailed understanding of complex assembly and function.

How does the genetic relationship between frdD and the ampC beta-lactamase gene influence antimicrobial resistance development?

The genetic relationship between frdD and the ampC beta-lactamase gene represents a critical intersection between central metabolism and antimicrobial resistance mechanisms in Enterobacteriaceae. This relationship has several important dimensions:

Genetic Organization and Regulatory Linkage:

The frd operon, which includes frdD, contains the promoter region of the ampC beta-lactamase gene . This genetic arrangement suggests potential co-regulation of anaerobic metabolism and beta-lactam resistance. Mutations in frdD have been identified in response to amoxicillin exposure, indicating a potential regulatory role in antimicrobial adaptation .

Mechanistic Implications:

Several mechanisms may explain how changes in frdD influence antimicrobial resistance:

  • Transcriptional cross-regulation: Alterations in frdD expression or structure may affect the activity of the ampC promoter, leading to changes in beta-lactamase production

  • Metabolic adaptation: Changes in fumarate reductase activity can alter cellular metabolism, potentially creating a more favorable intracellular environment for antibiotic tolerance

  • Stress response coordination: The genetic linkage may facilitate coordinated responses to both metabolic stress (requiring anaerobic respiration) and antibiotic stress

Experimental Evidence:

Recent research has identified mutations in frdD across multiple E. coli strains during adaptation to amoxicillin . The convergent evolution toward frdD mutations in independent experiments suggests strong selective pressure and a direct role in resistance adaptation rather than random genetic drift.

Notably, transcriptomic analysis of evolved strains revealed complex patterns of gene regulation. In certain genetic backgrounds (such as ΔdinB and ΔkatE strains), adaptation involved downregulation of stress response regulators prlF and yhaV, coupled with distinct sets of upregulated genes . This suggests that frdD may participate in complex adaptive networks that extend beyond direct antibiotic resistance mechanisms.

The relationship between frdD and antimicrobial resistance highlights the complex interconnections between core metabolism and adaptive responses in bacteria, suggesting that metabolic enzymes like fumarate reductase may serve as potential targets for combination therapies designed to overcome resistance mechanisms.

What role does frdD play in bacterial adaptation to environmental stressors beyond antimicrobial compounds?

The function of frdD extends beyond its role in antimicrobial resistance to encompass broader bacterial adaptation to diverse environmental stressors. This multifunctional nature positions frdD as a key component in bacterial stress response networks:

Metabolic Adaptation to Oxygen Limitation:

As part of the fumarate reductase complex, frdD is essential for anaerobic respiration, allowing bacteria to adapt to oxygen-limited environments. The ability to reduce fumarate as a terminal electron acceptor provides metabolic flexibility, enabling growth under conditions where aerobic respiration is not possible . This adaptation is particularly important in microenvironments such as biofilms, host tissues, and sediments where oxygen gradients exist.

Response to pH Fluctuations:

Fumarate reductase activity contributes to proton transport across the membrane, potentially helping to maintain pH homeostasis under acidic conditions. The membrane association facilitated by frdD is critical for this function, as it positions the enzyme complex appropriately within the membrane to contribute to proton motive force generation .

Adaptation to Nutrient Limitation:

Under nutrient-limited conditions, the ability to utilize alternative electron acceptors becomes crucial for survival. The fumarate reductase complex allows bacteria to maximize energy extraction from available carbon sources when preferred electron acceptors are absent. The proper assembly and membrane association of this complex, requiring frdD, is therefore essential for adaptation to nutrient-poor environments .

Thermal Stress Response:

The existence of thermophilic variants of fumarate reductase, such as in Methanothermobacter thermoautotrophicus, suggests that this enzyme also plays a role in adaptation to temperature extremes . While the structure differs (soluble versus membrane-bound), the conservation of the core catalytic function highlights its evolutionary importance across diverse thermal niches.

Integrative Stress Response Network:

Recent transcriptomic analyses have revealed connections between frdD and broader stress response networks. For example, in E. coli strains adapting to amoxicillin, mutations in frdD were associated with changes in expression of stress response regulators such as prlF and yhaV . This suggests that frdD may function as part of an integrated stress response system that coordinates adaptation to multiple environmental challenges simultaneously.

The multifaceted role of frdD in bacterial adaptation highlights the interconnectedness of metabolic functions and stress responses in bacteria. This integrated perspective is essential for understanding bacterial ecology and developing strategies to control bacterial growth in various contexts, from clinical infections to environmental management.

What are the potential applications of recombinant frdD in biotechnology and therapeutic development?

Recombinant fumarate reductase subunit D (frdD) presents several promising applications in both biotechnology and therapeutic development, leveraging its unique properties and functions:

Biocatalysis and Industrial Applications:

The fumarate reductase complex, with properly assembled frdD, can be harnessed for stereospecific conversion of fumarate to succinate, which has applications in:

  • Production of high-value chemicals and pharmaceutical intermediates

  • Green chemistry approaches requiring efficient electron transfer systems

  • Bioremediation systems targeting specific environmental contaminants

The key advantage of using recombinant frdD in these applications is the ability to engineer optimized enzyme complexes with enhanced stability, substrate specificity, or catalytic efficiency.

Antimicrobial Drug Development:

The essential role of frdD in anaerobic respiration and its genetic relationship with antimicrobial resistance mechanisms makes it a potential target for novel therapeutic approaches:

  • Development of small molecule inhibitors specifically targeting frdD-dependent membrane association

  • Design of peptidomimetics that disrupt the interaction between frdD and other fumarate reductase subunits

  • Creation of combination therapies targeting both fumarate reductase and conventional antimicrobial targets

These approaches could be particularly valuable against multidrug-resistant Enterobacteriaceae, where disruption of anaerobic metabolism might enhance susceptibility to existing antibiotics or provide alternative killing mechanisms.

Diagnostic Applications:

Recombinant frdD could serve as a valuable tool in diagnostic applications:

  • Development of antibodies against frdD for detection of specific bacterial species

  • Creation of biosensors utilizing frdD-dependent electron transfer mechanisms

  • Design of diagnostic platforms to detect mutations in frdD associated with emerging antimicrobial resistance

Synthetic Biology Platforms:

The well-characterized interactions between frdD and other fumarate reductase subunits provide a model system for synthetic biology applications:

  • Design of artificial electron transport chains with novel properties

  • Creation of synthetic microcompartments with specialized metabolic functions

  • Development of tunable gene expression systems responsive to anaerobic conditions

These emerging applications highlight the potential value of recombinant frdD beyond its native biological context, opening new avenues for research and development in biotechnology and medicine.

What are the most promising methodological advances for studying membrane protein complexes like fumarate reductase?

1. Advanced Structural Biology Techniques:

Cryo-Electron Microscopy (Cryo-EM):

  • Allows visualization of membrane proteins in near-native states without crystallization

  • Enables structural determination at near-atomic resolution

  • Can capture different conformational states of dynamic complexes

Integrative Structural Biology:

  • Combines multiple experimental techniques (X-ray crystallography, NMR, SAXS, crosslinking-MS)

  • Provides complementary structural information at different resolutions

  • Allows modeling of complete complexes even when individual components are difficult to study

2. Membrane Mimetic Systems:

Nanodiscs and Lipid Nanodiscs:

  • Provide a defined lipid bilayer environment surrounded by scaffold proteins

  • Enable purification and characterization of membrane proteins in a native-like environment

  • Compatible with various biophysical techniques including NMR and cryo-EM

Polymer-Based Membrane Mimetics:

  • Styrene-maleic acid lipid particles (SMALPs) allow direct extraction of membrane proteins with their surrounding lipids

  • Maintain native lipid interactions while improving stability

  • Compatible with functional assays and structural studies

3. Advanced Genetic and Molecular Biology Approaches:

CRISPR-Cas9 Genome Editing:

  • Enables precise modification of endogenous frd genes

  • Allows introduction of tags or reporter systems without disrupting native regulation

  • Facilitates creation of conditional knockout systems to study essential functions

Proximity-Based Labeling Techniques:

  • BioID or APEX2 fusions to frdD to identify interaction partners in living cells

  • Maps the protein interaction network in the native membrane environment

  • Captures transient interactions that may be lost during conventional purification

4. Single-Molecule Techniques:

Single-Molecule FRET:

  • Measures distances between labeled components of the fumarate reductase complex

  • Captures dynamic assembly processes and conformational changes

  • Works in membrane environments to provide functionally relevant information

High-Speed Atomic Force Microscopy:

  • Visualizes individual membrane protein complexes in native membranes

  • Captures dynamic structural changes during catalytic cycles

  • Provides topographical information complementary to other structural techniques

5. Computational Methods:

Molecular Dynamics Simulations:

  • Models membrane protein behavior in lipid bilayers over biologically relevant timescales

  • Predicts conformational changes, substrate interactions, and assembly processes

  • Integrates with experimental data to provide mechanistic insights

Machine Learning Approaches:

  • Improves protein structure prediction specifically for membrane proteins

  • Enhances interpretation of cryo-EM data for complex membrane assemblies

  • Facilitates analysis of large datasets from proteomic or functional studies

These methodological advances collectively provide researchers with unprecedented capabilities to study membrane protein complexes like fumarate reductase, potentially leading to new insights into their structure, function, and roles in bacterial physiology and pathogenesis.

What are the critical controls and validation steps when studying recombinant frdD function in heterologous expression systems?

When investigating recombinant frdD function in heterologous expression systems, implementing appropriate controls and validation steps is essential to ensure reliable and interpretable results. The following comprehensive framework addresses key experimental considerations:

Expression System Validation:

  • Vector Control Validation:

    • Empty vector controls to assess background activities and growth phenotypes

    • Vectors expressing non-functional frdD mutants to confirm specificity of observed effects

    • Positive control vectors expressing well-characterized membrane proteins to validate the expression system

  • Expression Verification:

    • Western blot analysis using antibodies against frdD or epitope tags

    • mRNA quantification via RT-PCR to confirm transcription

    • Fractionation studies to verify proper membrane localization

Functional Validation:

  • Complementation Controls:

    • Positive control: Complete frd operon expression to establish maximal complementation

    • Negative control: Host strain without complementation plasmids

    • Partial complementation: Expression of various subunit combinations to establish the requirement for frdD

  • Activity Assay Controls:

    • Enzyme-free reaction mixtures to establish background rates

    • Heat-inactivated enzyme preparations to control for non-enzymatic reactions

    • Purified commercial enzymes or native membrane preparations for comparison

  • Substrate Specificity Controls:

    • Testing structural analogues of fumarate to confirm specificity

    • Varying electron donors (NADH, reduced viologen dyes, quinols) to characterize electron transfer pathways

    • Oxygen-sensitivity controls to verify anaerobic functionality

Assembly and Interaction Validation:

  • Complex Formation Verification:

    • Co-immunoprecipitation of frdD with other fumarate reductase subunits

    • Size exclusion chromatography to confirm proper complex assembly

    • Blue native PAGE to visualize intact membrane protein complexes

  • Membrane Association Controls:

    • Comparison of membrane fractions from cells expressing full complex versus partial complexes lacking frdD

    • Detergent solubilization profiles to characterize membrane integration

    • Protease protection assays to determine topology

Genetic Validation Approaches:

  • Gene Arrangement Controls:

    • Comparison of operonic versus separated gene arrangements

    • Testing different gene orders to evaluate positional effects

    • Introduction of spacer sequences to assess effects of gene proximity

  • Mutant Library Analysis:

    • Alanine scanning mutagenesis of frdD to identify critical residues

    • Conservative versus non-conservative substitutions to assess functional requirements

    • Cross-species complementation to identify evolutionarily conserved functional domains

How can researchers effectively troubleshoot common challenges when working with recombinant frdD protein?

Working with recombinant frdD presents several challenges due to its hydrophobic nature, membrane association requirements, and functional dependence on other subunits. The following troubleshooting guide addresses common issues and provides methodological solutions:

Challenge 1: Poor Expression or Toxic Effects

ProblemPotential CausesTroubleshooting Solutions
Low protein yieldToxicity to host cellsUse tightly regulated inducible promoters with minimal leaky expression
Codon usage biasOptimize codons for expression host or use specialized strains with rare tRNAs
Protein instabilityLower induction temperature (16-20°C); add stabilizing agents like glycerol
Growth inhibitionMembrane disruptionUse lower induction levels; test different host strains with varied membrane compositions
Metabolic burdenDecrease expression time; use richer media with supplemental carbon sources

Challenge 2: Improper Membrane Association

ProblemPotential CausesTroubleshooting Solutions
Cytoplasmic aggregationAbsence of co-expressed frdCCo-express frdC and frdD from the same vector to facilitate proper membrane targeting
Improper foldingInclude molecular chaperones; optimize membrane composition
Hydrophobic mismatchTest different detergents or lipid compositions for membrane mimetics
No activity despite expressionImproper assemblyEnsure all four subunits are expressed in proximity; avoid separating frdC and frdD genes
Loss of cofactorsSupplement growth media with iron sources for Fe-S cluster assembly

Challenge 3: Purification Difficulties

ProblemPotential CausesTroubleshooting Solutions
Poor solubilizationInsufficient detergentTest detergent panel (DDM, LDAO, Triton X-100) at different concentrations
Strong membrane associationUse harsher solubilization conditions followed by detergent exchange
Protein-protein interactionsConsider purifying the entire complex rather than individual subunits
Aggregation during purificationDetergent removalMaintain critical micelle concentration throughout purification
Loss of stabilizing lipidsAdd specific lipids (cardiolipin, phosphatidylethanolamine) to buffers
Low purityNon-specific interactionsOptimize wash conditions; consider tandem affinity purification
Co-purifying proteinsUse size exclusion as final purification step; verify identity by mass spectrometry

Challenge 4: Activity Measurement Issues

ProblemPotential CausesTroubleshooting Solutions
No detectable activityImproper assay conditionsVerify anaerobic environment; optimize buffer conditions (pH 6.5 recommended)
Loss of electron transferTest multiple electron donors (NADH, viologens, etc.)
Incomplete complexEnsure all four subunits are present for membrane-bound activity
Inconsistent resultsOxygen sensitivityImprove anaerobic techniques; add reducing agents to buffers
Enzyme instabilityPrepare fresh enzyme preparations; avoid freeze-thaw cycles
Variable substrate qualityUse freshly prepared substrates; verify purity by HPLC

Challenge 5: Structural Analysis Challenges

ProblemPotential CausesTroubleshooting Solutions
Poor diffraction qualityConformational heterogeneityUse conformation-specific antibodies or nanobodies as crystallization chaperones
Detergent interferenceScreen detergent types and concentrations; try lipidic cubic phase crystallization
Low resolution in cryo-EMPreferred orientationUse different grid types; add specific amphipathic molecules
Conformational flexibilityEmploy classification algorithms; consider chemical crosslinking

By systematically addressing these common challenges using the suggested methodological solutions, researchers can more effectively work with recombinant frdD and successfully investigate its structure, function, and interactions within the fumarate reductase complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.