Recombinant Enterobacter sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Enterobacter sp. PlsY

Recombinant PlsY refers to the plsY gene product from Enterobacter sp. heterologously expressed in Escherichia coli (E. coli) for biochemical and industrial applications. Key features include:

PropertyDetail
Gene SourceEnterobacter sp. (e.g., strain 638)
Protein Length1-203 amino acids (partial/full-length variants)
TagHis-tag (N-terminal) for purification
Expression SystemE. coli
Purity>85% (SDS-PAGE confirmed)

Functional Role in Lipid Metabolism

PlsY catalyzes the conversion of G3P and acyl-phosphate to LPA, initiating the Kennedy pathway for phospholipid synthesis . Distinct from conventional GPATs that use acyl-CoA substrates, PlsY belongs to the acyl-phosphate-dependent GPAT family, prevalent in bacteria and mitochondria .

  • Substrate Specificity: Prefers acyl-phosphate over acyl-CoA, enabling unique metabolic flexibility in lipid remodeling .

  • Enzymatic Activity: Retains functionality in diverse pH and temperature conditions, with optimal activity at neutral pH .

Production and Purification

Recombinant PlsY is synthesized using codon-optimized plsY cloned into E. coli vectors (e.g., pET or pGEX systems) . Key steps include:

  1. Induction: IPTG-driven expression at 16–37°C .

  2. Purification: Immobilized metal affinity chromatography (IMAC) via His-tag .

  3. Storage: Stabilized in Tris-based buffer with 50% glycerol at -80°C .

Research Findings

  • Auxotroph Studies: Transposon mutagenesis in Enterobacter sp. YSU linked plsY disruption to auxotrophy, highlighting its role in lipid-dependent growth .

  • Kinetic Parameters:

    • K<sub>m</sub> for G3P: ~1,000–1,250 µM in mutant strains vs. ~90 µM in wild-type .

    • Inhibition: Sensitive to N-ethylmaleimide (NEM) and polymyxin B .

  • Biotechnological Relevance: Engineered E. coli strains expressing PlsY produce novel lipid droplets, aiding biofuel research .

Applications

  • Lipidomics: Tool for synthesizing deuterated phospholipid standards .

  • Antimicrobial Targets: Essential for bacterial membrane biogenesis, making it a candidate for antibiotic development .

  • Bioenergy: Enhances microbial triacylglycerol (TAG) production in biofuel feedstocks .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
plsY; Ent638_3462; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
plsY
Target Protein Sequence
MSAIAPGMIFLAYLCGSISSAILVCRIAGLPDPRVSGSGNPGATNVLRIGGKRAAVAVLV FDVLKGMLPVWGAYMLGVTPFWLGLIAIAACVGHIWPVFFHFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLSVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKKAPK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its role in bacterial physiology?

Glycerol-3-phosphate acyltransferase (plsY) is an integral membrane protein that plays a critical role in bacterial membrane phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acylphosphate to glycerol 3-phosphate, which represents a key step in phosphatidic acid formation . This reaction is part of the most widely distributed biosynthetic pathway for initiating phospholipid synthesis in bacteria . In this pathway, acyl-acyl carrier protein is first converted to acylphosphate by PlsX, and then PlsY transfers the acyl group to glycerol 3-phosphate . This process is essential for bacterial membrane formation and integrity, making PlsY a potential target for antimicrobial development.

How does the structure of PlsY contribute to its function?

PlsY has a distinctive membrane architecture that directly supports its enzymatic function. Studies on Streptococcus pneumoniae PlsY reveal that it contains five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane . The protein has three larger cytoplasmic domains, each containing a highly conserved sequence motif that is critical for catalysis . This architecture positions the active site residues optimally for substrate binding and catalytic activity. The membrane integration of PlsY is essential for its function as it facilitates access to both the water-soluble substrate (glycerol 3-phosphate) and the membrane-associated acylphosphate substrate.

What are the key conserved motifs in PlsY and their functional significance?

PlsY contains three highly conserved sequence motifs, each with distinct functional roles:

  • Motif 1: Contains essential serine and arginine residues that are critical for PlsY catalysis . These residues likely participate directly in the catalytic mechanism.

  • Motif 2: Exhibits characteristics of a phosphate-binding loop and corresponds to the glycerol 3-phosphate binding site . Mutations of the conserved glycines in this motif to alanines result in a Km defect for glycerol 3-phosphate binding, confirming its role in substrate interaction .

  • Motif 3: Contains a conserved histidine and asparagine that are important for activity, as well as a glutamate that is critical to the structural integrity of PlsY .

These motifs work in concert to facilitate substrate binding and catalysis, highlighting the evolutionary conservation of functionally important regions in the PlsY family of bacterial acyltransferases.

How does PlsY differ from other acyltransferases in the glycerolipid synthesis pathway?

While PlsY is a key acyltransferase in bacterial systems, it differs significantly from other glycerol-3-phosphate acyltransferases (GPATs) found in eukaryotes. In mammals, four isoforms of GPATs have been identified based on subcellular localization, substrate preferences, and N-ethylmaleimide (NEM) sensitivity . These are classified into two groups: GPAT1 and GPAT2 localized in the mitochondrial outer membrane, and GPAT3 and GPAT4 localized in the endoplasmic reticulum membrane .

In contrast, bacterial PlsY is an integral membrane protein with a unique structure and catalytic mechanism. Unlike eukaryotic GPATs that use acyl-CoA as a substrate, PlsY utilizes acylphosphate generated by PlsX . This difference in substrate preference represents a fundamental distinction in the mechanism of the first step of phospholipid biosynthesis between bacteria and eukaryotes.

What methods are recommended for generating recombinant Enterobacter sp. PlsY constructs?

For generating recombinant Enterobacter sp. PlsY constructs, researchers should consider the following methodological approach:

  • Plasmid Selection: Utilize a low-copy-number plasmid system such as pKOBEG, which contains a gene for chloramphenicol resistance and a temperature-sensitive origin of replication . This system provides tight control over expression levels, which is important for membrane proteins that may be toxic when overexpressed.

  • Transformation Protocol: Introduce the plasmid into Enterobacter sp. cells by heat shock transformation, selecting transformants on LB agar with appropriate antibiotics (e.g., chloramphenicol at 20-25 μg/ml) after incubation for 24 hours at 30°C .

  • Gene Amplification and Cloning: Amplify the plsY gene using PCR with primers designed with appropriate restriction sites. Include a purification tag (e.g., His-tag) to facilitate protein purification if expression and purification are the goals.

  • Expression Conditions: Optimize expression conditions including temperature (typically 16-30°C for membrane proteins), induction time, and inducer concentration to maximize the yield of functional protein.

  • Verification: Confirm the integrity of the recombinant construct through sequencing and expression analysis by Western blotting using antibodies against the purification tag or PlsY-specific antibodies.

This approach has been effectively used for similar recombinant protein productions in Enterobacter species and can be adapted specifically for PlsY based on its membrane protein characteristics .

How can site-directed mutagenesis be applied to study the catalytic mechanism of PlsY?

Site-directed mutagenesis is a powerful approach for elucidating the catalytic mechanism of PlsY. Based on research with Streptococcus pneumoniae PlsY, the following methodological framework is recommended:

  • Target Selection: Focus on the three conserved motifs identified in PlsY . Key residues for mutagenesis include:

    • Serine and arginine in Motif 1

    • Conserved glycines in Motif 2 (the phosphate-binding loop)

    • Histidine, asparagine, and glutamate in Motif 3

  • Mutagenesis Protocol: Use PCR-based site-directed mutagenesis with primers containing the desired mutations. For conservative mutations, consider:

    • Serine to alanine or threonine

    • Arginine to lysine

    • Glycine to alanine

    • Histidine to alanine or glutamine

    • Glutamate to aspartate

  • Activity Assays: Measure the enzymatic activity of mutant proteins using an acyltransferase assay. Determine kinetic parameters (Km, Vmax) to assess how mutations affect substrate binding and catalytic efficiency.

  • Structural Analysis: When possible, combine mutagenesis with structural studies (e.g., X-ray crystallography or cryo-EM) to visualize how mutations alter the protein conformation.

  • Complementation Studies: Test whether mutant PlsY can complement a PlsY-deficient bacterial strain to assess functional significance in vivo.

Through systematic mutagenesis of conserved residues, researchers can determine which amino acids are involved in substrate binding, catalysis, or structural integrity, thereby elucidating the catalytic mechanism of PlsY .

What experimental approaches are effective for determining the membrane topology of Enterobacter sp. PlsY?

To determine the membrane topology of Enterobacter sp. PlsY, researchers can adapt the substituted cysteine accessibility method (SCAM) that was successfully used for Streptococcus pneumoniae PlsY . The recommended experimental approach includes:

  • Cysteine Substitution Mutagenesis:

    • Generate a cysteine-less version of PlsY by mutating any native cysteines to serine

    • Introduce single cysteine residues at various positions throughout the protein sequence

    • Create a comprehensive panel of single-cysteine mutants covering different regions of the protein

  • Membrane Impermeant Sulfhydryl Reagents:

    • Treat intact cells or membrane preparations with membrane-impermeant thiol-reactive reagents (e.g., MTSET, MTSES)

    • These reagents will only modify cysteines exposed to the extracellular or periplasmic space

  • Membrane Permeant Controls:

    • Use membrane-permeant reagents (e.g., NEM) as positive controls to verify that all introduced cysteines are reactive

  • Detection Methods:

    • Assess modification using mass spectrometry

    • Alternatively, use cysteine-reactive fluorescent probes and measure fluorescence intensity

    • For some applications, assess the impact of modification on enzyme activity

  • Data Analysis and Modeling:

    • Plot the accessibility pattern of each position

    • Generate a topological model based on the alternating pattern of accessible and inaccessible residues

    • Validate the model using bioinformatic predictions and comparison with related proteins

This experimental approach can reveal the number of transmembrane segments, the orientation of loops, and the location of the N- and C-termini relative to the membrane, providing crucial structural information about Enterobacter sp. PlsY .

How can transposon-sequencing be applied to study the in vivo importance of plsY in Enterobacter species?

Transposon-sequencing (Tn-seq) is a powerful approach for studying the in vivo importance of genes like plsY in Enterobacter species. Based on methods applied to study Enterobacter cloacae, the following protocol is recommended:

  • Generation of Transposon Insertion Library:

    • Create a high-density random transposon insertion library in Enterobacter sp. using an appropriate transposon delivery system

    • Ensure sufficient coverage to disrupt virtually all non-essential genes in the genome

    • For E. cloacae ATCC 13047, libraries containing approximately 300,000 mutants have been successfully generated

  • In Vivo Selection:

    • Introduce the transposon library into an appropriate host model, such as Galleria mellonella (wax moth larvae), which has been used successfully for E. cloacae

    • Recover bacteria from the host after a defined period of colonization or infection

  • High-Throughput Sequencing:

    • Extract genomic DNA from both the input library and the bacteria recovered from the host

    • Amplify transposon-genome junctions using specialized PCR techniques

    • Sequence the amplicons using massively parallel sequencing platforms

  • Data Analysis:

    • Compare the frequency of transposon insertions in each gene between the input and output populations

    • Calculate fitness values based on the relative abundance of mutants

    • Identify genes where mutations result in negative selection (reduced fitness) or positive selection (enhanced fitness)

  • Validation of plsY Importance:

    • Generate a targeted plsY deletion mutant using the double crossing-over method with the pKOBEG plasmid

    • Assess the mutant's virulence in the Galleria mellonella model

    • Evaluate the mutant's ability to cope with various stresses (e.g., oxidative stress, antimicrobial agents)

This approach can provide valuable information about the importance of plsY for Enterobacter sp. fitness within the host and under various stress conditions, contributing to a better understanding of its role in pathogenesis .

What are the challenges in expressing and purifying functional recombinant PlsY?

Expressing and purifying functional recombinant PlsY presents several challenges due to its nature as an integral membrane protein. Researchers should be aware of these challenges and consider the following strategies:

Table 1: Challenges and Solutions for Recombinant PlsY Expression and Purification

ChallengeExplanationRecommended Solution
Membrane protein toxicityOverexpression can disrupt membrane integrityUse tightly regulated expression systems with inducible promoters; grow at lower temperatures (16-25°C)
Proper membrane insertionPlsY requires correct topology with five transmembrane segmentsExpress in bacterial systems with similar membrane composition to native environment; consider inclusion of chaperones
Low expression levelsCommon issue with membrane proteinsOptimize codon usage; use strong promoters balanced with toxicity concerns; consider fusion tags that enhance expression
Protein solubilizationExtracting PlsY from membranes without denaturationScreen multiple detergents (DDM, LDAO, etc.); use mild solubilization conditions; consider nanodiscs or amphipols for stabilization
Maintaining enzymatic activityDetergent can strip essential lipidsInclude phospholipids during purification; reconstitute into liposomes for activity assays
Protein aggregationCommon during concentration stepsAdd glycerol (10-15%); maintain detergent above critical micelle concentration; avoid freeze-thaw cycles
Purity assessmentDifficult for membrane proteinsUse size exclusion chromatography as final step; assess homogeneity by electron microscopy

By addressing these challenges systematically, researchers can improve the likelihood of obtaining functional recombinant PlsY suitable for biochemical and structural studies. The specific membrane topology of PlsY, with its five membrane-spanning segments and three cytoplasmic domains containing conserved catalytic motifs , makes its expression and purification particularly challenging but essential for detailed mechanistic studies.

How do inhibitors of PlsY affect bacterial membrane formation and viability?

Inhibitors of PlsY target a critical step in bacterial phospholipid biosynthesis, directly affecting membrane formation and bacterial viability. Research indicates that PlsY is noncompetitively inhibited by palmitoyl-CoA , suggesting that similar acyl-CoA analogs might serve as starting points for inhibitor development. When PlsY is inhibited, the transfer of acyl groups from acylphosphate to glycerol 3-phosphate is prevented, disrupting the initial step in phosphatidic acid formation.

The consequences of PlsY inhibition include:

  • Disrupted Membrane Phospholipid Composition: Inhibition leads to altered phospholipid profiles, affecting membrane fluidity and integrity.

  • Impaired Cell Division: Phospholipid synthesis is essential for cell division, as new membrane material must be synthesized for daughter cells.

  • Reduced Bacterial Viability: Complete inhibition of PlsY would prevent the formation of all phospholipids derived from phosphatidic acid, which are essential for membrane biogenesis.

  • Potential Synergistic Effects: PlsY inhibitors might synergize with other antimicrobials, particularly those that target membrane integrity or cell wall synthesis.

Given that PlsY represents the most widely distributed pathway for initiating phospholipid synthesis in bacteria , inhibitors of this enzyme could potentially have broad-spectrum antimicrobial activity. Additionally, since the bacterial PlsY pathway differs from the eukaryotic pathway (which uses GPAT enzymes with different structural and mechanistic characteristics ), selective inhibition of bacterial phospholipid synthesis is theoretically achievable.

What structure-activity relationships have been identified for potential PlsY inhibitors?

While comprehensive structure-activity relationship (SAR) studies specifically for Enterobacter sp. PlsY inhibitors are not fully detailed in the available search results, insights can be drawn from the reported noncompetitive inhibition by palmitoyl-CoA . Based on this information and general principles of enzyme inhibition, the following SAR considerations for potential PlsY inhibitors can be proposed:

  • Acyl Chain Length and Saturation: The inhibitory effect of palmitoyl-CoA suggests that compounds with long acyl chains (C16-C18) may effectively interact with PlsY. The degree of saturation may influence binding affinity and inhibitory potency.

  • Head Group Modifications: While palmitoyl-CoA has a CoA head group, modified head groups that mimic either acylphosphate or glycerol 3-phosphate might create competitive inhibitors that target the substrate binding sites in conserved motifs 1 and 2 .

  • Targeting Conserved Motifs: Compounds designed to interact with the three conserved motifs in PlsY, particularly:

    • Motif 1: Contains essential serine and arginine residues

    • Motif 2: Forms the phosphate-binding loop for glycerol 3-phosphate

    • Motif 3: Contains critical histidine, asparagine, and glutamate residues

  • Membrane-Associated Properties: Given PlsY's membrane localization with five membrane-spanning segments , effective inhibitors likely need to access the enzyme within the membrane environment. Compounds with appropriate hydrophobicity or amphipathic properties may be advantageous.

  • Species Specificity Considerations: While the core catalytic motifs are conserved across bacterial species, variations in non-conserved regions may allow for the development of species-specific inhibitors, potentially useful for targeting pathogenic Enterobacter species while sparing beneficial microbiota.

What gene deletion strategies are most effective for studying plsY function in Enterobacter species?

For studying plsY function in Enterobacter species, the double crossing-over method using the pKOBEG plasmid system has proven effective. This approach has been successfully applied to gene deletions in Enterobacter cloacae and can be adapted specifically for plsY. The recommended protocol includes:

  • Introduction of the Red Helper Plasmid:

    • Transform Enterobacter sp. with the pKOBEG plasmid by heat shock

    • Select transformants on LB agar with chloramphenicol (20-25 μg/ml)

    • Incubate at 30°C for 24 hours

  • Preparation of Electrocompetent Cells:

    • Grow a transformant carrying the Red helper plasmid

    • Prepare electrocompetent cells according to standard protocols

  • Generation of the Replacement Cassette:

    • Amplify a selectable kanamycin resistance gene using PCR

    • Design primers with 5' extensions that have homology to the regions flanking the plsY gene

    • The PCR product should contain FRT (Flippase Recognition Target) sequences flanking the kanamycin resistance gene to allow subsequent removal of the marker

  • Gene Replacement:

    • Electroporate the PCR product into the electrocompetent Enterobacter sp. cells

    • Select recombinants on LB agar with kanamycin (25 μg/ml)

    • Incubate at 30°C for 24 hours

  • Curing the Helper Plasmid:

    • Grow selected clones at 43°C to cure the temperature-sensitive pKOBEG plasmid

    • Verify loss of chloramphenicol resistance

  • Marker Removal (Optional):

    • Transform the mutant with plasmid pCP20 expressing FLP recombinase

    • FLP will recognize the FRT sites and excise the kanamycin resistance gene

    • Cure the pCP20 plasmid by growth at elevated temperature

  • Verification of Deletion:

    • Confirm the deletion by PCR and sequencing of the regions surrounding the deletion

    • Verify the phenotypic consequences of plsY deletion

This approach allows for precise deletion of the plsY gene while minimizing polar effects on neighboring genes, providing a clean genetic background for functional studies.

What complementation strategies should be considered when working with plsY mutants?

When working with plsY mutants in Enterobacter species, appropriate complementation strategies are essential to confirm that observed phenotypes are specifically due to the absence of plsY rather than polar effects or secondary mutations. The following complementation approaches are recommended:

  • Plasmid-Based Complementation:

    • Clone the wild-type plsY gene into a suitable expression vector for Enterobacter

    • Include the native promoter region to ensure physiological expression levels

    • Alternatively, use an inducible promoter system to control expression levels

    • Transform the plasmid into the plsY deletion mutant

    • Select transformants on appropriate antibiotics

  • Chromosomal Integration:

    • Reintroduce the plsY gene into the chromosome at a neutral site

    • Use a site-specific integration system (e.g., attB/attP-based)

    • This approach avoids copy number effects associated with plasmids

    • Verify correct integration by PCR and sequencing

  • Expression Level Considerations:

    • Monitor plsY expression levels by RT-qPCR or Western blotting

    • Ensure expression levels are comparable to wild-type bacteria

    • Both under- and over-expression can lead to misinterpretation of results

  • Functional Validation:

    • Measure membrane phospholipid composition in wild-type, mutant, and complemented strains

    • Assess growth rates under various conditions

    • Evaluate fitness in relevant in vivo models such as Galleria mellonella

  • Site-Directed Mutant Complementation:

    • Introduce plsY variants with specific mutations in conserved motifs

    • This approach can determine which residues are essential for function

    • Focus on the three conserved motifs identified in PlsY

Through careful complementation studies, researchers can confirm the specific role of plsY in observed phenotypes and gain insights into structure-function relationships within the protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.