Recombinant Enterobacter sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Genomic Context in Enterobacter sp. AS-1

The draft genome of Enterobacter sp. AS-1 reveals insights into its potential as a recombinant host :

Genomic FeatureEnterobacter sp. AS-1E. sichuanensisE. chengduensis
Genome Length (bp)5,205,6924,897,2013,264,334
GC Content (%)55.655.270.6
Coding Sequences (CDS)5,0134,5013,049
tRNA Genes864049

This strain’s high tRNA count and moderate GC content suggest robust translational efficiency, advantageous for recombinant protein expression .

Osmoregulation and Stress Response

MscL acts as an emergency valve, opening under hypoosmotic shock to prevent cell lysis. In Enterobacter, this function is critical for survival in fluctuating environments .

Recombinant Production

  • Expression Systems: Enterobacter sp. AS-1 has been proposed as a eurytrophic host for recombinant proteins . Analogous systems in E. coli use engineered strains (e.g., SuptoxR) to enhance MscL yields by co-expressing effector genes like rraA .

  • Purification and Reconstitution: Recombinant MscL is typically purified via affinity tags (e.g., glutathione S-transferase fusion) and reconstituted into liposomes for functional assays .

Research Findings and Innovations

  • Modulation Studies: Mutations (e.g., L89W) and small-molecule agonists (e.g., 011A) alter MscL gating thresholds, enabling controlled pore opening .

  • Biotechnological Applications:

    • Protein Excretion: MscL facilitates periplasmic excretion of recombinant proteins like eGFP under osmotic stress .

    • Antibiotic Adjuvants: MscL activators like 011A potentiate antibiotics by permeabilizing bacterial membranes .

Challenges and Future Directions

While Enterobacter sp. MscL shares functional homology with Ec-MscL and Tb-MscL, species-specific differences in lipid interactions and gating kinetics warrant further study . Advances in cryo-EM and molecular dynamics simulations are expected to refine mechanistic models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mscL; Ent638_3722; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
mscL
Target Protein Sequence
MSIVKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFMAIKLINRLNRKKEEPAAVPPAPSKEE VLLTQIRDLLKEQNNRI
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of MscL in Enterobacter species?

MscL (mechanosensitive channel of large conductance) functions as an emergency release valve during hypoosmotic shock in bacteria, including Enterobacter species. When bacteria experience a sudden decrease in external osmolarity, water rapidly enters the cell, causing swelling of the protoplast. To prevent cell lysis through osmotic bursting, MscL channels detect changes in membrane tension (turgor pressure) and open to release ions and osmolytes, thereby restoring osmotic balance . This adaptation mechanism is crucial for bacterial survival during transitions between environments with different osmolarities, such as during host colonization or release into environmental reservoirs .

MscL has the largest conductance among the mechanosensitive channels (approximately 3 nS), allowing for significant and rapid solute release when fully open. While most research has been conducted on E. coli MscL, the conservation of this channel across bacterial species suggests similar functions in Enterobacter species.

How does MscL structure relate to its mechanosensing function?

MscL's structure is specifically adapted to sense and respond to membrane tension. Based on structural studies of mechanosensitive channels, MscL likely contains multiple transmembrane domains that respond to membrane stretching. The channel's sensitivity to membrane tension is directly related to the lipid-protein interactions at the interface between the channel and the lipid bilayer .

Key structural features that contribute to mechanosensing include:

  • Transmembrane helices that respond to membrane stretching and thinning

  • A hydrophobic gate that prevents ion flux in the closed state

  • Specific lipid-binding sites that may amplify the sensing of membrane tension

Cryo-EM studies of E. coli MscS have revealed "a novel membrane-anchoring fold that plays a significant role in channel activation" and identified specific lipid densities that influence channel function . These include "a phospholipid that 'hooks' the top of each TM2-TM3 hairpin and likely plays a role in force sensing" . Similar mechanisms likely exist in MscL channels, where specific lipid-protein interactions would contribute to mechanosensation.

What methods can differentiate MscL activity from other mechanosensitive channels?

Distinguishing MscL activity from other mechanosensitive channels requires specific experimental approaches:

MethodDistinguishing FeaturesApplications
Patch-clamp electrophysiologyMscL has largest conductance (~90 pA at 20 mV in 200 mM KCl) Direct measurement of channel conductance and gating kinetics
Genetic knockoutsCreate ΔmscL strains to isolate effects of other channelsDetermine phenotypic contributions of individual channels
Osmotic shock survival assaysCompare wild-type and ΔmscL strainsAssess physiological role in osmotic protection
Specific inhibitorsApply compounds that selectively block individual channelsPharmacological isolation of channel activities

In electrophysiological recordings, MscL channels can be distinguished by their large conductance (~90 pA) compared to other mechanosensitive channels such as MscS (~25 pA), MscK (~17.5 pA), and MscM (smaller conductances) . Additionally, MscL typically gates at higher membrane tensions compared to MscS and MscK, allowing functional differentiation based on activation thresholds. Researchers often report channel activation as a ratio between the pressure required to open each channel and the pressure needed to open MscL in the same patch .

What are optimal expression systems for recombinant Enterobacter MscL?

The choice of expression system significantly impacts the yield and functionality of recombinant MscL. Based on successful approaches with other bacterial mechanosensitive channels, several expression systems can be considered:

For optimal expression, consider these methodological approaches:

  • Use inducible promoters (like PBAD or T7) to control expression levels and timing

  • Lower induction temperatures (16-25°C) often improve proper folding of membrane proteins

  • Co-express with chaperones to enhance proper folding

  • Include appropriate affinity tags (His6, FLAG) for purification while ensuring they don't interfere with function

  • Consider fusion partners that enhance expression or solubility

Research has shown that protein overexpression can lead to MscL-dependent excretion of cytoplasmic proteins (ECP) into the periplasmic space . This phenomenon should be considered when designing expression strategies, as it may affect yield and localization of the recombinant protein.

What purification strategies yield functional recombinant MscL?

Purifying functional MscL requires careful consideration of detergent selection and purification conditions:

For functional studies, consider reconstituting purified MscL into:

  • Liposomes for fluorescence-based assays or electrophysiology

  • Nanodiscs for structural studies and controlled lipid environments

  • Planar lipid bilayers for electrophysiological characterization

Throughout purification, maintain conditions that preserve protein functionality, including appropriate pH (typically 7.0-8.0), salt concentration (150-300 mM), and the continuous presence of detergents above their critical micelle concentration.

How can researchers design experiments to analyze MscL gating properties?

Studying MscL gating requires specialized approaches to apply and measure membrane tension while monitoring channel activity:

Experimental ApproachMeasured ParametersAdvantages
Patch-clamp electrophysiologySingle-channel conductance, gating threshold, kineticsDirect measurement of channel activity
Fluorescence-based liposome assaysSolute flux, population responseHigher throughput, no specialized equipment
Molecular dynamics simulationsStructural transitions, energy landscapesAtomic-level details of gating mechanism
Native mass spectrometryConformational changes, ligand bindingAnalysis directly from culture media

When designing patch-clamp experiments, researchers should:

  • Prepare protoplasts or reconstitute purified channels into liposomes or planar bilayers

  • Apply negative pressure gradually to identify gating thresholds

  • Record at different membrane potentials to characterize voltage dependence

  • Test various lipid compositions to assess lipid effects on gating

  • Quantify gating parameters relative to MscL in the same patch to normalize for variations in patch geometry

For fluorescence-based assays, reconstitute MscL into liposomes containing self-quenching fluorescent dyes. Channel opening upon osmotic downshock or membrane stretching will release the dye, resulting in increased fluorescence that can be quantified to assess channel activity.

Experiments should include proper controls such as known MscL variants (e.g., gain-of-function or loss-of-function mutants) and comparison with other mechanosensitive channels to ensure accurate interpretation of results.

How can researchers assess MscL-dependent protein excretion in Enterobacter species?

MscL has been implicated in the excretion of cytoplasmic proteins in E. coli, a process positively regulated by both osmotic stress and ArfA-mediated translational stress . To investigate this phenomenon in recombinant Enterobacter MscL systems, consider the following experimental approach:

  • Generate comparative strains:

    • Wild-type Enterobacter

    • ΔmscL knockout mutant

    • Complemented strain (ΔmscL + plasmid-expressed MscL)

    • Overexpression strain (with recombinant MscL)

  • Induce protein excretion:

    • Apply translation stress using subinhibitory antibiotic concentrations

    • Create osmotic stress conditions

    • Overexpress reporter proteins (e.g., eGFP, NusA)

  • Analyze protein localization:

    • Fractionate cells to separate cytoplasmic and periplasmic proteins

    • Quantify reporter proteins in each fraction by fluorescence (for eGFP) or Western blot (for other proteins)

Research has shown that in E. coli, periplasmic localization of recombinant proteins significantly decreases (5-fold) in ΔmscL mutants compared to wild-type strains, and this phenotype can be rescued by episomal expression of MscL . Similar approaches can be applied to study protein excretion in Enterobacter species.

For quantitative assessment, measure the periplasmic/cytoplasmic ratio of reporter proteins under different stress conditions and in different genetic backgrounds. Additionally, monitor cell viability to ensure that protein excretion is not simply due to cell lysis.

What methods can determine if MscL contributes to antibiotic susceptibility in Enterobacter?

Mechanosensitive channels have been implicated in antibiotic susceptibility through two contrasting mechanisms: serving as entry gates for antimicrobials and contributing to stress adaptation that enhances antibiotic tolerance . To investigate MscL's role in antibiotic susceptibility in Enterobacter species:

  • Compare antibiotic susceptibility profiles:

    • Determine minimum inhibitory concentrations (MICs) for various antibiotics in:

      • Wild-type Enterobacter

      • ΔmscL knockout mutant

      • MscL overexpression strain

  • Assess antibiotic uptake and accumulation:

    • Use fluorescently labeled antibiotics to track uptake

    • Measure intracellular antibiotic concentrations in different genetic backgrounds

    • Determine if osmotic shock-induced MscL activation affects antibiotic entry

  • Investigate heteroresistance phenomena:

    • Perform population analysis profiles (PAP) to detect heteroresistant subpopulations

    • Assess whether heteroresistance correlates with differential MscL expression or function

    • Determine if MscL contributes to the reversibility of resistance phenotypes

In Enterobacter cloacae complex, heteroresistance to ceftazidime has been observed, characterized by resistant subpopulations within a generally susceptible population . This heteroresistance is reversible, with resistant colonies reverting to susceptibility when grown without antibiotic pressure . Investigating whether MscL plays a role in this phenomenon could provide insights into both channel function and resistance mechanisms.

How do membrane lipid composition changes affect MscL gating properties?

Membrane lipid composition significantly influences MscL gating, as the channel directly senses membrane tension. To investigate these effects:

  • Reconstitute purified MscL in defined lipid systems:

    • Vary lipid headgroups (PC, PE, PG, CL)

    • Alter acyl chain length and saturation

    • Test effects of membrane-active compounds (cholesterol, detergents)

  • Measure gating parameters in different lipid environments:

    • Gating threshold (pressure required for activation)

    • Channel kinetics (opening/closing rates)

    • Conductance properties

  • Identify specific lipid-protein interactions:

    • Use cryo-EM to identify bound lipids, similar to the approach that revealed "a phospholipid that 'hooks' the top of each TM2-TM3 hairpin" in MscS

    • Perform molecular dynamics simulations to predict lipid binding sites

    • Use site-directed mutagenesis to disrupt specific lipid-protein interactions

For Enterobacter species, determining how native membrane composition affects MscL function could provide insights into the channel's role in this specific bacterial context and how it might differ from well-studied systems like E. coli.

How can MscL mutations inform structure-function relationships in mechanosensation?

Systematic mutagenesis of MscL can provide valuable insights into the molecular mechanisms of mechanosensation. Research approaches include:

  • Structure-guided mutagenesis:

    • Target conserved residues in transmembrane domains

    • Modify potential lipid-interacting residues

    • Alter the hydrophobic gate region

    • Mutate residues at subunit interfaces

  • Functional characterization of mutants:

    • Electrophysiological analysis to assess changes in:

      • Conductance

      • Gating threshold

      • Channel kinetics

      • Ion selectivity

    • Osmotic shock survival assays to evaluate physiological function

    • Structural studies to determine conformational changes

  • Data analysis and interpretation:

    • Correlate mutational effects with structural features

    • Develop models of the gating mechanism

    • Identify critical functional domains

Mutations in mechanosensitive channels can dramatically alter their properties. For example, in E. coli, expression of a mutant YbdG protein (V229A) significantly changed its electrophysiological characteristics, "increasing the observation of 7.5 pA openings" . Similar approaches with MscL can identify residues critical for sensing membrane tension or transducing this mechanical force into channel opening.

A comprehensive mutational analysis would systematically target different regions of MscL to build a functional map of the protein, identifying domains involved in mechanosensing, gating, and interaction with the membrane environment.

What experimental approaches can elucidate MscL's role in Enterobacter pathogenesis?

Investigating MscL's contribution to Enterobacter pathogenesis requires approaches that link channel function to virulence and adaptation during infection:

  • In vitro infection models:

    • Compare wild-type and ΔmscL Enterobacter in:

      • Adhesion to host cells

      • Invasion efficiency

      • Intracellular survival

      • Biofilm formation

    • Assess MscL expression under infection-relevant conditions

  • Animal infection models:

    • Evaluate colonization efficiency

    • Measure bacterial burden in tissues

    • Assess disease progression

    • Monitor host immune response

  • Osmotic adaptation studies:

    • Test survival during transitions between environments of different osmolarity

    • Assess adaptation to host niches with varying osmotic conditions

    • Investigate recovery after osmotic challenge

Mechanosensitive channels play important roles "during host colonization or release into environmental reservoirs" and help bacteria "adapt to osmotic changes occurring upon transitioning from the environment to the host and back" . For Enterobacter, which can cause infections in various body sites, MscL may be particularly important for adaptation to niches with varying osmotic conditions, such as the urinary tract where "osmolarity can change dramatically depending on the patient's water intake" .

Combining genetic manipulation (knockout, complementation, overexpression) with relevant infection models can establish whether MscL is a virulence factor or virulence-associated factor in Enterobacter pathogenesis.

How can researchers investigate the relationship between MscL and heteroresistance in Enterobacter species?

Heteroresistance—where a subpopulation of bacterial cells exhibits resistance within an otherwise susceptible population—has been observed in Enterobacter cloacae complex . Investigating potential connections between MscL and heteroresistance requires specialized approaches:

  • Single-cell analysis:

    • Measure MscL expression at the single-cell level using reporter fusions

    • Correlate MscL expression with antibiotic susceptibility

    • Assess membrane properties in resistant vs. susceptible subpopulations

  • Population dynamics studies:

    • Perform population analysis profiles (PAP) with wild-type and ΔmscL strains

    • Monitor the emergence and reversion of resistant subpopulations

    • Track changes in MscL expression during resistance development

  • Stress response connections:

    • Investigate whether translation stress affects both MscL function and heteroresistance

    • Determine if MscL-dependent protein excretion contributes to resistance mechanisms

    • Assess whether osmotic preconditioning affects antibiotic susceptibility

Heteroresistance in Enterobacter cloacae complex is characterized by its reversibility: "in the absence of the stressor (in this case, the antibiotic CAZ), the entirely resistant subpopulation reverts back to an almost susceptible population" . This phenomenon has been linked to gene duplication-amplification events , but membrane processes involving MscL might also contribute to this dynamic resistance phenotype.

How can researchers overcome challenges in electrophysiological studies of recombinant MscL?

Electrophysiological characterization of MscL presents several technical challenges:

ChallengeSolutionRationale
Low channel density in patchesOptimize expression conditionsEnsure sufficient channels per patch for reliable recordings
Difficulty forming stable gigasealsAdjust lipid compositionSome lipids facilitate seal formation with patch pipettes
Distinguishing MscL from other channelsUse genetic knockouts or specific conditionsCreate clean backgrounds for unambiguous identification
Variability in gating pressureReport pressure ratios relative to MscLNormalize for variations in patch geometry and properties

Methodological recommendations:

  • Protoplast preparation: Optimize protocols for generating stable protoplasts. Research has shown that "variations in the conditions for preparation of protoplasts" can affect the detection of mechanosensitive channels .

  • Patch stability: Use pipette glass with low noise characteristics and polish pipette tips to improve seal stability during pressure application.

  • Channel identification: Record at multiple holding potentials to characterize conductance and verify channel identity. MscL has a characteristic large conductance (~90 pA at 20 mV in 200 mM KCl) that distinguishes it from other mechanosensitive channels.

  • Data analysis: Apply appropriate filtering and analysis methods to extract single-channel properties, including conductance, gating threshold, and kinetics.

For reconstituted systems, ensure proper protein-to-lipid ratios to achieve an appropriate channel density that allows observation of single-channel events while avoiding excessive crowding that could affect membrane properties.

What controls are essential for studies of MscL-dependent protein excretion?

When investigating MscL-dependent protein excretion in Enterobacter species, several controls are essential to ensure valid and interpretable results:

  • Genetic controls:

    • Wild-type Enterobacter (positive control)

    • ΔmscL knockout mutant (negative control)

    • Complemented strain (ΔmscL + plasmid-expressed MscL) to confirm phenotype restoration

    • Strains lacking other mechanosensitive channels to control for redundancy

  • Cell integrity controls:

    • Monitor periplasmic markers that should not appear in the cytoplasm (e.g., alkaline phosphatase)

    • Assess cytoplasmic markers that should not appear in the periplasm without specific excretion

    • Verify cell viability to ensure excretion is not due to cell lysis or death

  • Experimental controls:

    • Include non-stress conditions as baseline

    • Use different reporter proteins to ensure the effect is not protein-specific

    • Apply osmotic shock protocols with appropriate controls for osmolarity

Research has shown that in E. coli, periplasmic localization of recombinant proteins occurs in wild-type cells but is significantly decreased in ΔmscL mutant strains (5-fold reduction, p = 9 × 10^-3) . This phenotype can be rescued by episomal expression of MscL . Similar controls should be established for Enterobacter species to confirm the MscL-dependence of protein excretion.

Additionally, verify that all strains demonstrate "viability comparable to that of the control strains" to ensure that differences in protein localization are not due to differential survival or growth rates.

How can researchers integrate structural and functional data to build comprehensive models of MscL action?

Developing comprehensive models of MscL function requires integration of diverse experimental data:

  • Structural data integration:

    • Combine information from:

      • Cryo-EM structures in different conformational states

      • X-ray crystallography of stable conformations

      • Molecular dynamics simulations of gating transitions

      • Distance measurements from FRET or crosslinking studies

  • Functional data correlation:

    • Map functional effects of mutations onto structural models

    • Correlate lipid effects with structural features

    • Relate electrophysiological properties to structural transitions

  • Model validation approaches:

    • Design mutations predicted to alter specific aspects of function

    • Test models with novel lipid environments or conditions

    • Develop computational simulations based on structural models and validate with functional data

Understanding "lipid-protein interactions" is crucial as they "represent the defining molecular process underlying mechanotransduction" . Structural studies have revealed specific lipid densities associated with mechanosensitive channels, including "a phospholipid that 'hooks' the top of each TM2-TM3 hairpin and likely plays a role in force sensing" . Incorporating such specific lipid-protein interactions into models of MscL function can provide insights into the molecular mechanisms of mechanosensation.

For comprehensive modeling, consider the entire cycle of MscL action, from initial sensing of membrane tension through conformational changes and gating to channel inactivation or closure. This approach will provide a more complete understanding of how MscL functions in the complex environment of the bacterial membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.