Recombinant Enterobacter sp. Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
lspA; Ent638_0585; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
lspA
Target Protein Sequence
MTKSFCSTGLRWLWLVVVVLIIDLGSKFLILQNFALGDTVPLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIALGICLVLTVMMYRAKASQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGNWHFATFNLADSAICFGAAMIVLEGFLPNAAAKKQA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein Signal Peptidase (LspA) and what role does it play in Enterobacter species?

Lipoprotein Signal Peptidase (LspA) is an essential enzyme in the bacterial lipoprotein biosynthetic pathway that carries out the second step in bacterial lipoprotein processing. LspA functions as a type II signal peptidase that specifically cleaves the signal peptide to the N-terminal side of the modified cysteine residue in prolipoproteins after they have been modified by Lgt (prolipoprotein diacylglyceryl transferase) . In Enterobacter species, as in other Gram-negative bacteria, LspA plays a crucial role in the maturation of lipoproteins, which are important for various cellular functions including membrane integrity, nutrient acquisition, and virulence. The enzyme is particularly significant in Enterobacteriaceae, including Enterobacter species, where lipoproteins contribute to antibiotic resistance mechanisms and bacterial pathogenesis . Recent genomic analyses of clinical Enterobacter isolates have revealed that LspA processing is consistent across the various species within the genus, although the specific lipoproteins being processed may vary, affecting resistance profiles and virulence characteristics .

Why is Enterobacter sp. LspA considered a potential target for antimicrobial development?

Enterobacter sp. LspA represents an attractive target for antimicrobial development due to several key characteristics that make it both biologically significant and therapeutically accessible. First, LspA is essential for bacterial viability in many Gram-negative bacteria, including Enterobacteriaceae, as it processes numerous lipoproteins critical for cellular functions and envelope integrity . Second, LspA has no mammalian homologs, which theoretically reduces the risk of off-target effects in humans, enhancing the selectivity profile of potential inhibitors. The growing clinical challenge of multidrug-resistant Enterobacter isolates, particularly in healthcare settings, has intensified the search for novel antibacterial targets like LspA . Moreover, inhibiting lipoprotein biosynthesis represents a mechanism distinct from conventional antibiotics, potentially circumventing existing resistance mechanisms. Natural products like globomycin have already demonstrated the feasibility of targeting LspA, although optimization is required to enhance potency against specific pathogens, as shown by the development of more potent analogs against pathogens like Acinetobacter baumannii .

What are the common methods for expressing and purifying recombinant Enterobacter sp. LspA?

Recombinant Enterobacter sp. LspA is typically expressed using bacterial expression systems, with E. coli being the most common heterologous host due to its well-established genetic tools and rapid growth characteristics. The expression construct generally includes the lspA gene with an affinity tag (commonly His6 or FLAG) to facilitate purification, and expression is often driven by an inducible promoter system such as T7 or arabinose-inducible promoters to control protein production . Due to LspA's multiple transmembrane domains, specialized approaches are necessary, including the use of detergent-based extraction methods or membrane-mimicking environments to maintain protein stability and function during purification. A common purification protocol involves bacterial cell disruption followed by membrane fraction isolation through differential centrifugation, solubilization of membrane proteins using appropriate detergents (such as n-dodecyl-β-D-maltoside or Triton X-100), and affinity chromatography using the engineered tag . Additional purification steps, including size exclusion chromatography or ion exchange chromatography, may be employed to achieve higher purity, particularly for structural studies or enzymatic assays requiring homogeneous protein preparations.

How can researchers confirm the enzymatic activity of purified recombinant Enterobacter sp. LspA?

Researchers can verify the enzymatic activity of purified recombinant Enterobacter sp. LspA through several complementary approaches that assess its ability to cleave prolipoprotein substrates. One common method involves in vitro assays using synthetic peptide substrates containing the lipobox motif and a diacylglyceryl modification, with cleavage products detected through mass spectrometry or HPLC analysis . Alternatively, researchers may use fluorescence resonance energy transfer (FRET)-based assays with specially designed substrates that produce measurable signals upon cleavage by active LspA. Functional complementation assays represent another valuable approach, where the recombinant LspA is expressed in an lspA-deficient bacterial strain to assess whether it restores normal growth and lipoprotein processing. The inhibition of purified LspA activity by known inhibitors like globomycin can serve as a positive control to confirm specific enzymatic activity rather than non-specific proteolysis . Additionally, researchers may track the processing of specific prolipoproteins through Western blot analysis in both in vitro reconstituted systems and in bacterial cells expressing the recombinant enzyme.

What are the essential experimental controls when studying recombinant Enterobacter sp. LspA?

When studying recombinant Enterobacter sp. LspA, researchers must implement several critical experimental controls to ensure the validity and reproducibility of their findings. First, negative controls should include inactive LspA variants generated through site-directed mutagenesis of catalytic residues (typically conserved aspartates), which should demonstrate loss of enzymatic function while maintaining similar expression levels and structural integrity . Positive controls should incorporate known LspA substrates from Enterobacter species or close relatives with confirmed processing patterns to establish baseline enzymatic activity. When analyzing inhibitor effects, researchers should include established LspA inhibitors like globomycin as reference compounds alongside appropriate vehicle controls to distinguish specific inhibition from non-specific effects . For cellular studies, complementation experiments should include both empty vector controls and wild-type LspA expression to confirm that observed phenotypes are specifically due to LspA activity. Temperature-sensitive controls may also be valuable, as LspA activity can be affected by temperature, providing an additional parameter to verify enzyme-specific effects versus non-specific outcomes.

How do mutations in the substrate recognition site of Enterobacter sp. LspA affect its substrate specificity and enzymatic efficiency?

Mutations in the substrate recognition site of Enterobacter sp. LspA can significantly alter both its substrate specificity and catalytic efficiency, with profound implications for bacterial physiology and potential drug development strategies. Research indicates that specific amino acid residues in the substrate binding pocket of LspA interact directly with the lipobox motif ([LVI][ASTVI][GAS]C) of prolipoproteins, influencing substrate recognition and positioning for catalysis . Mutations affecting these interactions can lead to altered substrate preferences, potentially causing differential processing of the various lipoproteins present in Enterobacter species. Studies examining resistance mechanisms to LspA inhibitors have revealed that changes in the substrate recognition site can affect susceptibility to inhibitors while simultaneously modifying the enzyme's ability to process certain prolipoproteins . Advanced site-directed mutagenesis studies, coupled with enzymatic assays using diverse synthetic substrates, can systematically map the contribution of specific residues to substrate recognition and catalysis. Structural biology approaches, including crystallography or cryo-EM of the enzyme-substrate complex, combined with molecular dynamics simulations, provide deeper insights into how mutations affect the dynamics of substrate binding and the catalytic mechanism.

What mechanisms contribute to resistance against LspA inhibitors in Enterobacter species?

Resistance to LspA inhibitors in Enterobacter species can arise through multiple sophisticated mechanisms that highlight the adaptability of bacterial defense systems. Unlike in E. coli, where resistance to LspA inhibitors is primarily mediated through deletion or decreased expression of the major outer membrane lipoprotein Lpp, Enterobacter may employ alternative strategies due to differences in lipoprotein profiles . One significant mechanism involves mutations in the signal peptides of abundant lipoproteins processed by LspA, similar to the mutations observed in the LirL lipoprotein of Acinetobacter baumannii that confer resistance to globomycin analogs . These signal peptide mutations likely decrease substrate sensitivity to LspA processing, thereby reducing the cellular impact when LspA is inhibited. Another potential mechanism involves alterations in the expression levels or structures of specific lipoproteins that are critical for cellular functions, effectively bypassing the requirement for LspA processing. Genomic analyses of resistant Enterobacter isolates may reveal mutations in the lspA gene itself, particularly in regions involved in inhibitor binding, which could directly affect inhibitor efficacy without compromising enzymatic function .

How does the interaction between recombinant Enterobacter sp. LspA and globomycin analogs differ from interactions with other bacterial LspA enzymes?

The interaction between recombinant Enterobacter sp. LspA and globomycin analogs exhibits distinct characteristics compared to interactions with LspA from other bacterial species, reflecting differences in enzyme structure and the bacterial envelope composition. Research indicates that while globomycin effectively inhibits LspA across many bacterial species, its potency and binding kinetics vary significantly between organisms, with generally lower effectiveness against non-fermenting Gram-negative bacteria compared to Enterobacteriaceae . Structural studies and computational modeling suggest that specific amino acid variations in the binding pocket of Enterobacter sp. LspA may contribute to altered interaction dynamics with globomycin analogs. The optimization of globomycin analogs, such as G5132, has demonstrated that chemical modifications can enhance inhibitor penetration through the outer membrane and improve target engagement with LspA in different bacterial species . The development of resistance to these inhibitors further highlights species-specific differences, as the critical lipoproteins involved in resistance mechanisms differ between bacterial species—for example, the identification of LirL in A. baumannii versus Lpp in E. coli suggests that analogous but distinct lipoproteins may play similar roles in Enterobacter species .

What are the optimal conditions for assessing inhibitor efficacy against recombinant Enterobacter sp. LspA?

The optimal assessment of inhibitor efficacy against recombinant Enterobacter sp. LspA requires carefully controlled experimental conditions that balance physiological relevance with reproducibility and quantitative precision. In vitro enzymatic assays should be conducted in a membrane-mimicking environment, such as detergent micelles or proteoliposomes, to maintain LspA in its native conformation and orientation . The reaction buffer should mimic physiological conditions (pH 7.0-7.5, 150 mM NaCl) while including appropriate cofactors that may enhance enzymatic activity. Substrate selection is crucial, with synthetic peptides containing the specific Enterobacter lipobox sequences and proper diacylglyceryl modification providing the most relevant targets. For accurate determination of inhibitory potency, researchers should establish dose-response relationships across a wide concentration range (typically 0.1-100 μM) and calculate IC50 values through non-linear regression analysis . Time-course experiments are essential to distinguish between reversible and irreversible inhibition mechanisms, with pre-incubation studies revealing potential time-dependent inhibition. Complementary whole-cell assays using Enterobacter strains or heterologous expression systems should accompany in vitro studies to confirm that observed inhibitory effects translate to the cellular context, where factors like membrane permeability and efflux may influence inhibitor efficacy.

How can researchers effectively study the protein-protein interactions between LspA and its lipoprotein substrates in Enterobacter?

Investigating protein-protein interactions between LspA and its lipoprotein substrates in Enterobacter requires sophisticated approaches that capture these transient membrane-associated interactions. Cross-linking techniques utilizing photoactivatable or chemical cross-linkers can trap the enzyme-substrate complex in situ, allowing subsequent purification and identification of interaction partners through mass spectrometry . Co-immunoprecipitation experiments using antibodies against tagged versions of either LspA or specific lipoproteins can pull down interaction complexes, although careful optimization is needed to preserve membrane protein interactions during solubilization. Fluorescence-based techniques, including FRET or bimolecular fluorescence complementation (BiFC), can visualize these interactions in living cells when the proteins are tagged with appropriate fluorescent proteins, providing spatial and temporal information about the interactions . Surface plasmon resonance (SPR) or bio-layer interferometry with purified components in detergent micelles or nanodiscs offers quantitative binding parameters including association and dissociation rates. Additionally, bacterial two-hybrid systems adapted for membrane proteins can screen for interactions in a cellular context, while hydrogen-deuterium exchange mass spectrometry can map specific interaction interfaces between LspA and its substrates with high resolution.

What are the recommended protocols for site-directed mutagenesis of Enterobacter sp. LspA to study structure-function relationships?

Site-directed mutagenesis of Enterobacter sp. LspA requires specialized protocols that account for the challenges associated with membrane protein manipulation while ensuring precise genetic modifications. Researchers should begin with a codon-optimized synthetic gene cloned into a vector with an inducible promoter and appropriate affinity tags to facilitate subsequent purification and detection . PCR-based mutagenesis methods, such as QuikChange or Q5 site-directed mutagenesis, are recommended for introducing specific mutations, with special attention to primer design to ensure specificity when targeting regions with high GC content or secondary structures. Alanine-scanning mutagenesis of conserved residues, particularly the catalytic aspartates and residues lining the substrate binding pocket, provides systematic insight into functionally critical amino acids. Conservative substitutions (e.g., Asp to Glu) can distinguish between residues involved in catalysis versus structural integrity . Following mutagenesis, rigorous verification through DNA sequencing is essential before proceeding to expression studies. Expression levels of mutant proteins should be confirmed through Western blotting, with membrane localization assessed through fractionation studies to ensure proper insertion. Functional characterization should include both in vitro enzymatic assays and complementation studies in LspA-deficient strains to correlate structural modifications with functional outcomes.

How should researchers interpret changes in LspA activity when comparing wild-type and mutant Enterobacter strains?

When comparing LspA activity between wild-type and mutant Enterobacter strains, researchers must employ multifaceted analytical approaches to distinguish direct enzymatic effects from downstream consequences. Quantitative enzymatic activity measurements should be normalized to LspA expression levels, as determined by Western blot or mass spectrometry, to account for potential differences in protein abundance between strains . Researchers should examine both the rate and efficiency of prolipoprotein processing by monitoring the accumulation of unprocessed prolipoproteins and the appearance of mature lipoproteins across multiple substrates, as mutations may differentially affect the processing of specific lipoproteins. Changes in LspA activity should be correlated with broader phenotypic alterations, including growth rate, cell morphology, membrane integrity, and stress responses, to understand the physiological impact of altered lipoprotein processing . Statistical analysis must account for biological variability, with appropriate tests (e.g., ANOVA with post-hoc comparisons) applied to determine the significance of observed differences. When interpreting inhibitor susceptibility data, resistance phenotypes should be confirmed through multiple methodologies, including minimum inhibitory concentration (MIC) determinations, time-kill kinetics, and direct enzymatic assays to establish causative relationships between genetic alterations and resistance mechanisms.

What statistical approaches are most appropriate for analyzing inhibitor efficacy data against recombinant Enterobacter sp. LspA?

The statistical analysis of inhibitor efficacy data for recombinant Enterobacter sp. LspA requires rigorous approaches tailored to the specific experimental design and data characteristics. For in vitro enzyme inhibition studies, non-linear regression analysis using four-parameter logistic models is recommended for accurate determination of IC50 values, with 95% confidence intervals reported to indicate precision . Researchers should perform replicate experiments (minimum n=3) and consider both technical and biological variability in their statistical design. When comparing multiple inhibitors, one-way ANOVA followed by appropriate post-hoc tests (e.g., Tukey's HSD for all pairwise comparisons or Dunnett's test when comparing to a control) provides robust statistical framework for identifying significant differences in potency . For time-dependent inhibition studies, two-way ANOVA incorporating both concentration and time as variables can reveal interaction effects. Whole-cell inhibition data should be analyzed using similar approaches, with MIC90 values determined from dose-response curves generated from multiple independent experiments. Correlation analyses between in vitro potency and whole-cell activity can identify compounds with favorable penetration properties, while systematic structure-activity relationship analyses require multivariate statistical methods to correlate molecular features with inhibitory potency.

How can researchers effectively correlate LspA inhibition with changes in Enterobacter species' virulence and pathogenicity?

Establishing meaningful correlations between LspA inhibition and alterations in Enterobacter virulence requires comprehensive analytical frameworks that bridge molecular mechanisms and pathogenic outcomes. Researchers should implement dose-dependent studies correlating inhibitor concentration with both LspA enzymatic inhibition and quantifiable virulence phenotypes, establishing causality through statistical correlation analyses . Cell culture infection models using relevant human cell lines can assess changes in bacterial adhesion, invasion, and intracellular survival following LspA inhibition, with quantitative analysis of host cell responses (cytokine production, inflammatory markers) providing insight into pathogen-host interactions. Animal infection models, appropriately designed with power analyses to ensure statistical significance, enable evaluation of in vivo virulence parameters including bacterial burden, tissue damage, and survival outcomes following treatment with LspA inhibitors . Transcriptomic and proteomic profiling of Enterobacter species under LspA inhibition can reveal broader changes in virulence factor expression, with pathway analysis and gene ontology enrichment identifying affected virulence networks. Specific virulence mechanisms potentially impacted by lipoprotein processing disruption, such as membrane integrity, outer membrane vesicle formation, or type III secretion system function, should be systematically assessed through specialized assays correlated with LspA inhibition levels.

What are the major technical challenges in studying recombinant Enterobacter sp. LspA, and how might they be overcome?

Studying recombinant Enterobacter sp. LspA presents several significant technical challenges inherent to membrane protein research, requiring innovative approaches for resolution. The hydrophobic nature of LspA, with multiple transmembrane domains, complicates expression and purification, often resulting in protein aggregation or misfolding . This challenge can be addressed through optimization of expression systems, including the use of specialized E. coli strains designed for membrane protein expression (e.g., C41/C43(DE3)), and careful selection of detergents or membrane-mimicking systems like nanodiscs or styrene-maleic acid lipid particles (SMALPs) for extraction and stabilization. Another major obstacle involves developing reliable activity assays that accurately reflect the enzyme's natural function within the membrane environment, which can be approached through the design of native-like proteoliposome systems incorporating fluorescent or chromogenic substrates . Structural characterization presents additional challenges, as membrane proteins are notoriously difficult to crystallize; emerging approaches combining cryo-electron microscopy with computational modeling offer promising alternatives for elucidating LspA structure. The complex interactions between LspA and the diverse lipoprotein substrates in Enterobacter species further complicate functional studies, necessitating comprehensive proteomic approaches to identify and characterize the complete lipoprotein profile and processing patterns.

How might genomic and proteomic approaches advance our understanding of LspA function in different Enterobacter species?

Genomic and proteomic approaches offer powerful tools to illuminate the diverse roles of LspA across different Enterobacter species, providing system-level insights into lipoprotein processing networks. Comparative genomic analyses of multiple Enterobacter species and strains can identify conservation patterns in lspA genes and their genetic contexts, revealing potential regulatory mechanisms and evolutionary relationships . Whole genome sequencing of clinical isolates with varying antimicrobial susceptibility profiles enables correlation between lspA genetic variations and resistance phenotypes, potentially identifying naturally occurring mutations that affect inhibitor binding or enzymatic function . Transcriptomic studies under various stress conditions can reveal how lspA expression is regulated in response to environmental cues, while ribosome profiling may uncover translational control mechanisms. Proteomic approaches, particularly quantitative techniques like SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling, can comprehensively identify the lipoproteome of different Enterobacter species and monitor changes in lipoprotein processing upon LspA inhibition or mutation . Advanced techniques like protein correlation profiling and proximity labeling (BioID or APEX) can map the protein interaction network surrounding LspA, revealing functional associations and regulatory partners within the bacterial envelope.

What novel therapeutic strategies might emerge from improved understanding of LspA inhibition in Enterobacter species?

Advanced understanding of LspA inhibition in Enterobacter species is poised to catalyze several innovative therapeutic strategies that address the growing challenge of multidrug resistance. Structure-based drug design, informed by detailed knowledge of Enterobacter sp. LspA's active site and inhibitor binding pockets, can guide the development of species-selective inhibitors with enhanced potency and reduced potential for resistance development . Combination therapy approaches pairing LspA inhibitors with conventional antibiotics may create synergistic effects, particularly with agents targeting cell envelope integrity, as disruption of lipoprotein processing likely increases susceptibility to membrane-active compounds. The identification of species-specific abundant lipoproteins in Enterobacter, analogous to LirL in A. baumannii, offers potential for developing targeted approaches that exploit the unique lipoprotein profiles of these pathogens . Nanoparticle-based delivery systems could improve the penetration of LspA inhibitors through the complex Gram-negative cell envelope, addressing a key challenge in antibiotic development against these pathogens. Additionally, understanding resistance mechanisms against LspA inhibitors enables the design of collateral sensitivity strategies, where resistance to one agent creates vulnerability to another, potentially allowing for cycling approaches that limit resistance emergence in clinical settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.