Recombinant Enterobacter sp. NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Ent638_2832; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVVAHHWAFAIFLIVAIGLCCLMLIGGWFLGGRARARHKNTPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRI GALDWTPTRSRRELVNPENSNSNRQQ
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase subunit A (nuoA) in Enterobacter species?

NADH-quinone oxidoreductase subunit A (nuoA) is part of the NADH dehydrogenase complex that plays a crucial role in the respiratory chain of Enterobacter species. This enzyme complex catalyzes the transfer of electrons from NADH to quinone, coupled with proton translocation across the membrane, contributing to the proton motive force for ATP synthesis. In Enterobacter aerogenes, the NADH dehydrogenase complex is particularly important in anaerobic metabolism, where manipulation of its components has been shown to redirect electron flow toward hydrogen production .

How does nuoA interact with other subunits in the NADH dehydrogenase complex?

NuoA functions as an integral membrane subunit within the larger NADH dehydrogenase complex, interacting with other membrane components like nuoH, nuoJ, and nuoK. It helps anchor the peripheral arm of the complex (which includes nuoC, nuoD, and nuoE) to the membrane domain. Research on E. aerogenes has demonstrated that targeted modifications of individual subunits can alter the efficiency of electron transfer through the complex, suggesting significant interdependence among these subunits . When designing experiments to modify nuoA expression, researchers should consider the potential effects on the stability and function of the entire complex.

What cloning vectors are most suitable for expressing recombinant nuoA in Enterobacter species?

For heterologous expression of nuoA in Enterobacter species, plasmids such as pET-28a have demonstrated efficacy, as evidenced by successful expression of other genes in E. aerogenes . When selecting a vector, consider compatibility with the host strain, appropriate antibiotic resistance markers (kanamycin resistance at 25-50 μg/mL has shown good results), and promoter strength. Expression vectors with the T7 promoter system work effectively in Enterobacter species, though proper induction conditions must be optimized. The choice between high-copy and low-copy vectors depends on whether you aim to achieve high protein expression or avoid metabolic burden on the host.

What are the most effective CRISPR-Cas9 strategies for nuoA gene editing in Enterobacter species?

Based on successful CRISPR-Cas9 applications in E. aerogenes for other nuo genes, effective nuoA editing would likely utilize a similar two-plasmid system: a pCas9 vector expressing Cas9 and recombination proteins, and a pTarget vector carrying a specific sgRNA targeting nuoA . Key considerations include:

  • Designing sgRNA with minimal off-target effects using established algorithms

  • Creating homology arms of approximately 500-700bp flanking the targeted nuoA region

  • Implementing temperature-sensitive plasmid systems (repA101) for efficient plasmid curing

  • Verifying deletions through PCR and sequencing

Researchers should be aware that transformation efficiency in Enterobacter species may be lower than in E. coli, requiring optimization of electroporation parameters and recovery conditions.

How can the intracellular NADH/NAD+ ratio be optimized after nuoA modification to maximize hydrogen production?

Optimizing the NADH/NAD+ ratio following nuoA modification requires a multi-faceted approach:

  • Heterologous expression of NAD synthetase (nadE) from organisms like Klebsiella pneumoniae has shown efficacy in increasing NADH availability in E. aerogenes mutants

  • Co-expression of small RNA RyhB can further enhance NADH-dependent pathways by regulating iron-sulfur cluster proteins involved in competing pathways

  • Culture optimization including glucose concentration (15 g/L), proper buffer systems (phosphate buffer), and strict anaerobic conditions

The following table summarizes potential strategies based on research with other nuo subunit modifications:

StrategyMechanismExpected Effect on NADH/NAD+Implementation Method
nadE overexpressionIncreases NAD+ synthesisHigher total nucleotide pool with greater NADH regenerationPlasmid-based expression (e.g., pET-28a-nadE)
RyhB overexpressionRepresses competing pathwaysRedirects electron flow to hydrogen productionPlasmid-based expression (e.g., pKK102-ryhB-cm)
Combination approachSynergistic enhancementMaximizes both NADH availability and utilizationDual plasmid system with compatible origins

What are the optimal culture conditions for analyzing hydrogen production in nuoA-modified Enterobacter strains?

Optimal culture conditions for hydrogen production analysis in nuoA-modified strains should follow established protocols for other nuo-modified E. aerogenes strains. Specifically:

For bench-scale experiments:

  • Use serum bottles (50 mL) containing 30 mL of glucose fermentation medium

  • Ensure strict anaerobic conditions by nitrogen purging for at least 10 minutes

  • Maintain temperature at 37°C with agitation at 200 rpm

  • Culture for 20 hours, with hydrogen collection and measurement after CO₂ removal through 5M sodium hydroxide

For scaled-up experiments:

  • Implement fed-batch cultivation in bioreactors (5L) with 3L working volume

  • Maintain nitrogen sparging to ensure anaerobic conditions

  • Sample regularly (every 2 hours) for metabolite analysis

  • Monitor biomass and pH continuously throughout fermentation

How can Northern blot analysis be optimized for studying small RNA interactions with nuoA expression?

Northern blot analysis for examining small RNA (such as RyhB) interactions with nuoA expression requires careful RNA handling and specific protocol adaptations:

  • Extract total RNA using methods that preserve small RNA integrity (e.g., hot phenol extraction or commercial kits specifically designed for small RNA preservation)

  • Use RNase-free experimental materials and wear appropriate protective equipment to prevent RNA degradation

  • Store extracted RNA at -80°C immediately after concentration and purity testing

  • For gel electrophoresis, consider using higher percentage gels (8-15% polyacrylamide) to better resolve small RNAs

  • Use specific, labeled probes targeting the small RNA of interest and potential binding regions on nuoA mRNA

Verification of small RNA expression should be performed before mechanistic studies to ensure that observed effects can be attributed to the small RNA rather than other factors.

What verification methods are most reliable for confirming successful nuoA gene editing in Enterobacter species?

Based on established protocols for other nuo genes, a comprehensive verification approach for nuoA gene editing should include:

  • PCR screening with primers flanking the targeted deletion region, with expected band size changes corresponding to the deletion

  • Sequencing of the modified region to confirm exact nucleotide changes

  • Transcript analysis via RT-PCR to verify absence of nuoA expression

  • Protein analysis techniques such as Western blotting (if appropriate antibodies are available) or enzymatic activity assays to confirm functional deletion

  • Phenotypic verification through measurement of NADH dehydrogenase activity and hydrogen production capabilities

For CRISPR-Cas9 edited strains, additional verification of plasmid curing is essential before proceeding with physiological characterization.

How should researchers interpret conflicting data on nuoA knockout effects between liquid culture and bioreactor experiments?

When facing discrepancies between small-scale liquid culture and bioreactor experiments with nuoA knockouts, researchers should consider several factors:

  • Scale-dependent effects: Oxygen transfer rates, mixing efficiency, and gas-liquid mass transfer coefficients differ significantly between scales, potentially affecting redox balance and NADH utilization

  • Environmental homogeneity: Bioreactors typically provide more homogeneous environments than shake flasks, eliminating microenvironments that might mask true phenotypes

  • Temporal dynamics: Longer fermentation times in bioreactors may reveal delayed effects not observed in short-term culture experiments

To reconcile conflicting data, implement a systematic approach:

  • Conduct time-course sampling in both systems

  • Analyze key metabolites at multiple time points

  • Measure gene expression at different growth phases

  • Consider intermediate-scale validation experiments

What statistical approaches are most appropriate for analyzing hydrogen production data from nuoA-modified strains?

Given the variability inherent in biological hydrogen production systems, robust statistical approaches should include:

  • Minimum of three biological replicates for all experiments, as implemented in successful E. aerogenes studies

  • Application of appropriate parametric tests (ANOVA with post-hoc tests like Tukey's HSD) for comparing hydrogen yields between different strains

  • Time-series analysis methods for rate data rather than simple endpoint measurements

  • Multivariate analysis techniques when examining relationships between hydrogen production and multiple metabolites

  • Clear reporting of variability (standard deviation or standard error) for all quantitative measurements

How is genome-wide analysis being used to understand nuoA interaction networks in Enterobacter species?

Recent genomic epidemiology studies of Enterobacter species have expanded our understanding of gene interaction networks . While direct nuoA interaction studies are emerging, researchers are increasingly using techniques such as:

  • RNA-Seq to identify genes co-regulated with nuoA under various conditions

  • ChIP-Seq to identify transcription factors regulating nuoA expression

  • Whole-genome sequencing to identify natural variants and their phenotypic effects

  • Comparative genomics across Enterobacter species to understand evolutionary conservation of nuoA and interacting partners

These approaches are revealing how nuoA functions within broader cellular contexts, particularly in relation to carbapenem resistance mechanisms that may interact with respiratory chain components .

What emerging genetic engineering approaches beyond CRISPR-Cas9 show promise for nuoA modification in Enterobacter species?

While CRISPR-Cas9 has revolutionized gene editing in Enterobacter species , several emerging approaches show promise for nuoA modification:

  • Base editing: Allows for precise nucleotide substitutions without double-strand breaks, potentially useful for creating point mutations in nuoA to study structure-function relationships

  • Prime editing: Offers greater precision for introducing specific mutations or small insertions/deletions

  • CRISPRi/CRISPRa: Enables reversible repression or activation of nuoA without permanent genetic changes

  • MAGE (Multiplex Automated Genome Engineering): Allows simultaneous modification of multiple targets, useful for studying nuoA in conjunction with other nuo subunits

Each approach has specific advantages depending on research goals, from studying nuoA essentiality through conditional repression to creating libraries of nuoA variants for structure-function analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.