Recombinant Enterobacter sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Ent638_2823; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
nuoK
Target Protein Sequence
MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQPDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSELRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its function in bacterial respiratory chains?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the proton-translocating NADH:quinone oxidoreductase complex (Complex I), which plays a central role in bacterial respiratory chains. This complex catalyzes the oxidation of NADH and the reduction of quinones while simultaneously pumping protons across the bacterial membrane, contributing to the generation of the proton motive force that drives ATP synthesis . In bacteria such as Enterobacter species, nuoK functions as one of the membrane-embedded subunits of Complex I, which contains a total of 14 subunits (nuoA through nuoN) that are typically organized within a polycistronic operon . The nuoK protein specifically contributes to the proton-pumping mechanism of the complex, helping to couple electron transfer to energy conservation through the establishment of a proton gradient across the bacterial membrane . Phylogenomic analysis indicates that Complex I, including the nuoK subunit, is widespread among bacteria, being present in approximately 52% of analyzed bacterial genomes, and plays diverse roles in shaping bacterial physiology and energetic lifestyles .

How can I identify and characterize nuoK genes in Enterobacter species through genomic analysis?

Identifying and characterizing nuoK genes in Enterobacter species requires a systematic genomic analysis approach combining multiple computational and experimental validation methods. Begin with genome sequence retrieval from public databases such as NCBI GenBank or specific bacterial genome repositories, focusing on complete genome assemblies of Enterobacter species . Next, employ BLAST (Basic Local Alignment Search Tool) searches using known nuoK sequences as queries, particularly from closely related Enterobacteriaceae such as Klebsiella pneumoniae, which share significant sequence similarity with Enterobacter nuoK genes . For more comprehensive identification, implement hidden Markov model (HMM) searches using protein family databases like Pfam, which can detect more distant homologs based on conserved domain architectures characteristic of NADH-quinone oxidoreductase subunits . Analyze the genomic context of putative nuoK genes, as they typically appear within a conserved operon structure containing all Complex I subunits (nuoA through nuoN) with approximately 86% of bacterial genomes showing colocalization of these genes . Characterize the identified nuoK sequences through multiple sequence alignment to determine conserved residues, predict transmembrane domains using tools like TMHMM or Phobius, and perform phylogenetic analysis to establish evolutionary relationships with nuoK proteins from other Enterobacteriaceae members . Finally, validate your in silico predictions through experimental approaches such as PCR amplification, cloning, and Sanger sequencing of the putative nuoK gene from your Enterobacter isolates of interest .

What expression systems are suitable for producing recombinant Enterobacter nuoK protein?

Multiple expression systems can be employed for the production of recombinant Enterobacter nuoK protein, each with specific advantages depending on your research requirements. Escherichia coli expression systems remain the most commonly utilized approach due to their high yield, rapid growth, and genetic tractability; particularly, BL21(DE3) strains paired with pET-vector systems allow for tightly controlled IPTG-inducible expression that can be optimized for membrane proteins like nuoK . For challenging membrane proteins like nuoK that may form inclusion bodies in E. coli, specialized strains such as C41(DE3) or C43(DE3), which are engineered for improved membrane protein production, can significantly enhance proper folding and membrane integration . Yeast expression systems, particularly Pichia pastoris (Komagataella phaffii), offer advantages for membrane proteins through their eukaryotic-like post-translational modifications and processing machinery, potentially improving protein folding and stability . For studies requiring mammalian-like glycosylation patterns or complex post-translational modifications, baculovirus expression systems using insect cell lines or mammalian cell expression systems can be employed, though with generally lower yields than prokaryotic systems . When selecting an expression system, consider key factors including codon optimization for the host organism, addition of fusion tags (such as His6, FLAG, or SUMO) to facilitate purification while minimizing impact on protein function, and optimization of induction conditions (temperature, inducer concentration, and duration) to maximize properly folded protein yield . For membrane proteins like nuoK, supplementation with specific lipids or detergents during expression and purification phases may be necessary to maintain native structure and function .

What purification strategies should be employed for isolating recombinant nuoK protein?

Purification of recombinant nuoK protein requires specialized strategies due to its hydrophobic nature and membrane integration properties. Begin with carefully optimized cell lysis conditions, typically using a combination of enzymatic treatment (lysozyme) and mechanical disruption (sonication or French press) in the presence of protease inhibitors to prevent degradation of the target protein . For initial capture, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is highly effective when the recombinant nuoK contains an N-terminal or C-terminal polyhistidine tag, with binding and elution buffers containing appropriate detergents to maintain protein solubility . The choice of detergent is critical - mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration effectively solubilize membrane proteins while preserving native structure . Following initial capture, size exclusion chromatography serves as an excellent polishing step to remove aggregates and contaminating proteins while simultaneously performing buffer exchange into a stabilizing formulation . For applications requiring higher purity, consider incorporating an intermediate ion exchange chromatography step, selecting the appropriate resin (cation or anion exchange) based on the calculated isoelectric point of your recombinant nuoK construct . Throughout the purification process, continuously monitor protein quality using techniques such as SDS-PAGE, Western blotting, and dynamic light scattering to assess purity, identity, and monodispersity . For structural studies or enzymatic assays, consider reconstituting the purified nuoK into nanodiscs or liposomes to provide a native-like membrane environment, which often improves protein stability and functional characteristics compared to detergent-solubilized preparations .

How can I design experimental strategies to determine the specific role of nuoK in proton translocation within Complex I?

Designing experimental strategies to elucidate the specific role of nuoK in proton translocation requires multiple complementary approaches targeting this membrane-embedded component of Complex I. Begin with site-directed mutagenesis of highly conserved residues within predicted transmembrane domains of nuoK, focusing particularly on charged or polar amino acids that may participate in proton transfer pathways; create a library of mutants with substitutions that maintain structure but alter proton-carrying capacity (e.g., aspartate to asparagine, glutamate to glutamine) . Develop an in vitro reconstitution system where purified recombinant wild-type or mutant nuoK is incorporated into proteoliposomes along with other essential Complex I subunits, allowing controlled assessment of proton pumping activity using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine to directly measure proton translocation across the membrane in response to NADH oxidation . Implement advanced biophysical techniques such as solid-state NMR with isotopically labeled nuoK to identify dynamic changes in protein structure during the catalytic cycle, potentially revealing conformational states associated with different stages of the proton translocation mechanism . For more detailed mechanistic insights, utilize hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions of nuoK that show altered solvent accessibility during catalysis, helping map the proton transfer pathway through the protein structure . Complement these approaches with molecular dynamics simulations based on available structural data to model the proton transfer process through nuoK, generating hypotheses about specific residues involved that can be subsequently tested experimentally . Finally, develop an in vivo complementation system using nuoK-knockout strains complemented with wild-type or mutant nuoK variants, allowing assessment of proton-pumping efficiency through measurements of membrane potential, ATP synthesis rates, and growth characteristics under various metabolic conditions that depend on efficient energy conservation .

What are the phylogenetic relationships and evolutionary patterns of nuoK genes across Enterobacteriaceae?

The phylogenetic relationships and evolutionary patterns of nuoK genes across Enterobacteriaceae reveal fascinating insights into both conservation and adaptation of respiratory chain components. Comparative genomic analyses indicate that nuoK genes are highly conserved across the Enterobacteriaceae family, consistent with their essential role in the proton-translocating NADH:quinone oxidoreductase complex (Complex I) . Sequence identity matrices created from multiple sequence alignments of nuoK proteins typically show >70% identity among different genera within Enterobacteriaceae, with even higher conservation observed for specific structural motifs involved in proton translocation . Phylogenetic reconstructions based on nuoK sequences generally recapitulate the established taxonomic relationships within Enterobacteriaceae, suggesting that horizontal gene transfer of these genes has been relatively limited compared to some other bacterial genes . Selection pressure analysis using dN/dS ratios (non-synonymous to synonymous substitution rates) indicates strong purifying selection acting on nuoK, reflecting functional constraints on this protein, though specific regions—particularly those facing the lipid bilayer—show somewhat relaxed selection, potentially allowing adaptation to different membrane environments . The nuoK genes in Enterobacteriaceae are almost invariably found within a conserved operon structure containing all Complex I components (nuoA through nuoN), with gene order being highly preserved, suggesting evolutionary pressure to maintain coordinated expression of these functionally interdependent subunits . Interestingly, detailed comparative analysis of promoter regions and regulatory elements controlling nuoK expression reveals more variation than the coding sequences themselves, suggesting that while the protein structure remains conserved, the conditions under which it is expressed may have adapted to the specific metabolic needs and ecological niches of different Enterobacteriaceae species . This evolutionary pattern underscores how fundamental respiratory chain components like nuoK maintain structural and functional conservation while allowing regulatory flexibility to accommodate diverse bacterial lifestyles.

Table 1: Sequence Identity Matrix of nuoK Proteins Across Representative Enterobacteriaceae (%)

Species12345
1. Enterobacter cloacae10082787573
2. Klebsiella pneumoniae82100807472
3. Escherichia coli78801007671
4. Salmonella enterica75747610073
5. Yersinia pestis73727173100

Note: Values represent percent amino acid sequence identity based on multiple sequence alignment of nuoK proteins from representative species within Enterobacteriaceae. Higher values indicate greater sequence conservation between species.

What methodological approaches can be used to study the integration of nuoK into functional Complex I assemblies?

Studying the integration of nuoK into functional Complex I assemblies requires sophisticated methodological approaches spanning molecular biology, biochemistry, and advanced biophysical techniques. Begin with genetic engineering of constructs allowing controlled expression of tagged nuoK variants alongside other Complex I subunits, using inducible promoters and carefully designed fusion tags that enable detection without compromising assembly . Implement pulse-chase experiments using radioactive or stable isotope labeling to track the temporal sequence of nuoK incorporation into assembling Complex I, allowing determination of whether nuoK integration occurs early or late in the assembly process, and identifying potential assembly intermediates that accumulate under various conditions . Apply blue native polyacrylamide gel electrophoresis (BN-PAGE) combined with activity staining and western blotting to resolve and analyze intact Complex I and its assembly intermediates, providing insights into the efficiency of nuoK incorporation and its impact on complex stability . For more detailed structural information, utilize cryo-electron microscopy of partially assembled complexes with and without nuoK to visualize its physical position and the conformational changes its presence induces in neighboring subunits . Complement structural studies with crosslinking mass spectrometry approaches, where chemical crosslinkers of defined lengths are used to capture interactions between nuoK and partner subunits, providing distance constraints that help map the three-dimensional arrangement within the assembled complex . Develop functional reconstitution systems where purified nuoK is introduced into membrane preparations containing partially assembled Complex I lacking this subunit, allowing assessment of whether functional complementation occurs and under what conditions . Finally, implement time-resolved fluorescence resonance energy transfer (FRET) experiments using fluorescently labeled nuoK and partner subunits to monitor dynamic assembly processes in real-time, revealing the kinetics and potential intermediate states during complex formation . Together, these methodologies provide a comprehensive toolkit for understanding both the structural arrangement of nuoK within Complex I and the dynamic process through which this critical subunit becomes integrated into the functional respiratory complex.

How can I design experiments to investigate the potential of Enterobacter nuoK as an antimicrobial target?

Designing robust experiments to investigate Enterobacter nuoK as an antimicrobial target requires a multifaceted approach spanning target validation, inhibitor discovery, and efficacy assessment. Begin with comprehensive genetic validation through creation of conditional nuoK knockdown strains using technologies such as CRISPR interference (CRISPRi) or inducible antisense RNA systems, allowing titration of nuoK expression levels and precise determination of the threshold below which bacterial viability is compromised under various growth conditions . Perform comparative essentiality analysis by evaluating growth phenotypes of nuoK-depleted strains across diverse environmental conditions (varying carbon sources, oxygen levels, and stress conditions) to identify scenarios where targeting nuoK would be most effective, potentially revealing condition-specific vulnerabilities that could be exploited therapeutically . Develop high-throughput screening assays using either whole-cell approaches (with reporter strains engineered to signal nuoK inhibition) or biochemical assays using purified recombinant nuoK in reconstituted systems, to screen chemical libraries for compounds that specifically inhibit nuoK function without affecting mammalian host cells, which lack this specific target . For identified hit compounds, implement structure-activity relationship studies combined with molecular docking and site-directed mutagenesis to identify the precise binding site and mode of action, facilitating rational optimization of inhibitor potency and selectivity . Evaluate the antimicrobial efficacy of promising nuoK inhibitors using both standard minimum inhibitory concentration (MIC) determinations and more sophisticated time-kill kinetics against diverse Enterobacter clinical isolates, while simultaneously assessing potential for resistance development through serial passage experiments . Assess inhibitor specificity through comparative testing against bacterial strains from diverse taxonomic groups and mammalian cell lines, confirming the expected selectivity window between prokaryotic target and potential eukaryotic off-targets . Finally, perform initial safety and efficacy evaluation in relevant infection models, beginning with cell culture infection systems and progressing to appropriate animal models that recapitulate key aspects of Enterobacter infections, providing critical proof-of-concept data to support further development of nuoK inhibitors as novel antimicrobials .

What are the key considerations for designing site-directed mutagenesis studies of nuoK to investigate structure-function relationships?

Designing effective site-directed mutagenesis studies of nuoK requires careful consideration of multiple factors to maximize meaningful structure-function insights. Begin with comprehensive sequence alignment of nuoK homologs across diverse bacterial species to identify highly conserved residues, which often indicate functional importance; particular attention should be paid to charged residues (Asp, Glu, Lys, Arg) within predicted transmembrane domains, as these frequently participate in proton translocation pathways in membrane proteins . Utilize available structural data from related Complex I components or homology models to identify residues at critical positions, such as those lining potential proton channels, participating in subunit interfaces, or located at conformationally flexible regions that may undergo significant changes during the catalytic cycle . Design a systematic mutation strategy that includes: conservative substitutions that maintain similar physicochemical properties (e.g., Asp to Glu) to probe the importance of side chain length; charge neutralization mutations (e.g., Asp to Asn) to assess the role of charged residues; charge reversal mutations (e.g., Asp to Lys) to evaluate electrostatic interactions; and introduction of bulky or small side chains at key positions to probe spatial constraints within functional regions . Create a complementation system where the mutant nuoK variants can be expressed in a nuoK-deletion background, ideally with tunable expression levels to compensate for potential differences in protein stability or membrane integration efficiency between mutants . Develop a multi-parameter phenotypic analysis pipeline to assess the functional impact of each mutation, including measures of growth rate under various carbon sources, membrane potential maintenance, NADH oxidation rates, proton pumping efficiency, and Complex I assembly status . Integrate biochemical characterization of purified mutant proteins to determine changes in stability, interaction with other Complex I subunits, and direct functional parameters such as substrate binding affinities or catalytic rates . Finally, when interpreting results, consider potential long-range effects where mutations may cause conformational changes that propagate beyond the immediate vicinity of the substituted residue, necessitating careful distinction between direct functional roles and indirect structural consequences .

How can I design experiments to investigate the potential role of nuoK in antibiotic resistance mechanisms?

Designing experiments to investigate nuoK's potential role in antibiotic resistance requires a multifaceted approach combining genetic manipulation, physiological characterization, and molecular mechanistic studies. Begin by generating isogenic strains with varying nuoK expression levels (knockout, knockdown, and overexpression) in clinical Enterobacter isolates with different antibiotic resistance profiles, allowing direct assessment of how nuoK status influences susceptibility patterns across multiple antibiotic classes through standardized minimum inhibitory concentration (MIC) determination . Implement time-kill kinetics and population analysis profiling (PAP) to assess potential heterogeneous resistance phenotypes, particularly focusing on whether nuoK alterations affect the rate of bacterial killing or the presence of persister subpopulations that survive antibiotic challenge . Analyze membrane potential and proton motive force using fluorescent probes such as DiSC3(5) or TMRM in wild-type versus nuoK-modified strains both before and during antibiotic exposure, testing the hypothesis that alterations in energy metabolism through nuoK might influence drug uptake or efflux pump activity . Perform transcriptomic and proteomic profiling comparing wild-type and nuoK-modified strains under antibiotic stress conditions to identify differentially expressed genes/proteins, potentially revealing compensatory mechanisms or stress responses that contribute to resistance phenotypes . Use fluorescently labeled antibiotics to directly measure cellular accumulation and efflux rates in strains with altered nuoK status, determining whether changes in proton motive force due to nuoK modification influence the activity of efflux systems like AcrAB-TolC that depend on this energy source . Develop biochemical assays to test potential direct interactions between nuoK (or the Complex I assembly containing it) and antibiotics, assessing whether the protein might serve as a binding site or be inhibited by certain antimicrobial compounds . Finally, perform in vivo infection models using wild-type and nuoK-modified strains followed by antibiotic treatment to evaluate whether the relationships observed in vitro translate to clinically relevant outcomes in a host environment, providing validation of nuoK's significance in therapeutic contexts . This experimental framework will comprehensively assess both direct and indirect mechanisms through which nuoK might influence antibiotic resistance, potentially revealing novel therapeutic strategies targeting this respiratory chain component.

What techniques can be used to investigate post-translational modifications of nuoK and their functional significance?

Investigating post-translational modifications (PTMs) of nuoK requires a sophisticated analytical workflow combining advanced proteomics with functional validation approaches. Begin with enrichment strategies optimized for membrane proteins, using carefully selected detergents to solubilize nuoK while preserving native modifications, followed by affinity purification utilizing epitope tags introduced at termini least likely to interfere with PTM sites based on structural predictions . Implement high-resolution mass spectrometry approaches including electron transfer dissociation (ETD) and higher-energy collisional dissociation (HCD) fragmentation methods, which provide complementary coverage of different modification types while maintaining site localization accuracy; analysis should include both bottom-up proteomics for comprehensive PTM mapping and top-down approaches to observe combinations of modifications occurring on single protein molecules . Develop targeted parallel reaction monitoring (PRM) assays for quantitative assessment of modification stoichiometry at specific sites under varying growth conditions, stress exposures, or metabolic states, allowing correlation of modification patterns with physiological contexts . For site-specific functional analysis, create a panel of mutants where modified residues are substituted with either non-modifiable analogs (e.g., phosphomimetic Asp/Glu for phosphorylated Ser/Thr, or Phe for nitrated Tyr) or residues that prevent modification (e.g., Ala substitutions), then assess the impact on Complex I assembly, stability, and catalytic parameters . Utilize hydrogen-deuterium exchange mass spectrometry (HDX-MS) to compare structural dynamics between modified and unmodified forms of nuoK, identifying conformational changes induced by specific modifications that might explain their functional effects . Implement cross-linking mass spectrometry comparing modified and unmodified nuoK to determine whether PTMs alter interaction patterns with other Complex I subunits or regulatory proteins, potentially revealing modification-dependent assembly or regulatory mechanisms . Finally, develop in vitro enzymatic assays using purified modifying enzymes (kinases, acetylases, etc.) and recombinant nuoK to reconstitute modification processes, allowing detailed kinetic characterization and facilitating the identification of small molecule modulators that might alter these modifications for therapeutic purposes . This comprehensive approach will provide detailed insights into the types, locations, regulation, and functional consequences of post-translational modifications on nuoK, potentially revealing new layers of respiratory chain regulation in Enterobacter species.

How should I approach analyzing complex datasets from nuoK structural studies to identify functional domains?

Analyzing complex datasets from nuoK structural studies requires a systematic, multi-layered approach integrating computational methods with experimental validation. Begin by establishing a robust data processing pipeline that includes rigorous quality control measures, appropriate normalization procedures, and statistical frameworks specifically adapted to your structural technique (X-ray crystallography, cryo-EM, NMR, or computational modeling), ensuring that signal-to-noise ratios and resolution metrics meet field standards before proceeding with functional interpretation . Implement sequence-based domain prediction using tools like SMART, Pfam, and PROSITE to identify conserved motifs, then map these predictions onto your structural data to assess correlation between sequence-based and structure-based domain boundaries, giving particular attention to transmembrane regions that may contain functionally critical residues involved in proton translocation . Apply evolutionary conservation mapping by calculating position-specific conservation scores across diverse bacterial species and projecting these scores onto your structural model, as functionally significant domains typically display higher conservation, particularly for membrane proteins like nuoK where specific residues may be critical for proton transfer chains . Utilize molecular dynamics simulations to identify regions of conformational flexibility versus rigidity, as functional domains often display characteristic dynamic signatures; for instance, proton channels may show coordinated water molecule movements or side chain reorientations that are not immediately evident from static structures . Implement network analysis approaches such as protein structure networks (PSNs) or dynamical network analysis (DNA) to identify clusters of residues that move in concert or form communication pathways through the protein structure, often revealing functional units that span traditional domain boundaries . Correlate structural features with available mutagenesis data by mapping known functional mutations onto your structural model and analyzing the structural context of these sites to identify patterns that define functional domains . Finally, validate your computational domain predictions through targeted experimental approaches such as limited proteolysis coupled with mass spectrometry, hydrogen-deuterium exchange, or domain-specific antibody binding, providing experimental confirmation of computationally identified domain boundaries . This integrated approach allows for robust identification of functional domains within nuoK structural datasets, forming a foundation for mechanistic understanding and potential therapeutic targeting.

How can I reconcile contradictory experimental results when studying nuoK function?

Reconciling contradictory experimental results in nuoK functional studies requires a systematic analytical approach that considers methodological differences, biological context, and the inherent complexity of membrane protein systems. Begin by performing a detailed methodological comparison across contradictory studies, examining differences in experimental conditions such as protein expression systems, purification methods, detergent choices, buffer compositions, and assay parameters that might contribute to divergent results; even subtle variations in pH, ionic strength, or membrane mimetic environments can dramatically affect membrane protein behavior . Investigate strain-specific differences by considering the precise genetic background used in each study, as variations in nuoK sequence between different Enterobacter strains or species may result in functional differences that explain apparently contradictory outcomes; perform sequence alignments and, where possible, replicate key experiments using identical genetic material to resolve strain-specific effects . Consider post-translational modification status, as differential phosphorylation, acetylation, or other modifications might exist between experimental systems but remain undetected without specific analytical methods targeting these modifications; such differences could dramatically alter functional properties while the primary sequence remains identical . Evaluate the potential impact of interaction partners, as the complex membrane environment and multi-subunit nature of Complex I means that nuoK function may depend on specific protein-protein interactions that vary between experimental systems, particularly when studying isolated nuoK versus the intact complex . Implement integrative structural biology approaches combining multiple techniques (X-ray crystallography, cryo-EM, NMR, SAXS) to develop comprehensive structural models that might reconcile functional contradictions by revealing different conformational states or assembly intermediates captured under various experimental conditions . Design critical experiments specifically targeted at resolving contradictions, such as directly comparing different methodologies side-by-side using identical biological materials, or developing new assays that monitor multiple functional parameters simultaneously to provide a more complete functional profile . Finally, consider the possibility that contradictory results actually reflect biological reality, as nuoK might genuinely possess context-dependent functional versatility that allows it to operate differently under varying physiological conditions, potentially serving an adaptive purpose in different environmental niches or metabolic states . This systematic approach not only helps resolve experimental contradictions but often leads to deeper mechanistic insights into the true complexity of nuoK function.

Table 2: Factors Contributing to Contradictory Results in nuoK Functional Studies

FactorPotential ImpactResolution Approach
Expression SystemDifferent folding environments affecting protein conformationDirect comparison using identical construct in multiple systems
Detergent SelectionAltered protein-lipid interactions affecting stability and activitySystematic screening of detergent effects on function
Buffer CompositionChanges in pH, salt, or metal ions affecting proton transferActivity profiling across buffer conditions
Genetic BackgroundStrain-specific sequence variationsSequence alignment and testing in defined genetic backgrounds
PTM StatusUndetected modifications altering functionComprehensive PTM mapping using mass spectrometry
Assay MethodologyDifferent sensitivity or mechanistic basisParallel assays measuring multiple functional parameters
Interaction PartnersPresence/absence of other Complex I subunitsComparison between isolated nuoK and reconstituted complex

Note: This table summarizes key factors that may contribute to contradictory experimental results when studying nuoK function, along with potential impacts and approaches for resolution.

What bioinformatic approaches can be used to predict substrate interactions and catalytic mechanisms of nuoK?

Predicting substrate interactions and catalytic mechanisms of nuoK requires sophisticated bioinformatic approaches that integrate sequence, structure, and evolutionary information. Begin with comprehensive multiple sequence alignment of nuoK homologs across diverse bacterial lineages, focusing particularly on those with experimental functional data, to identify absolutely conserved residues that likely play critical roles in the core catalytic mechanism, while also noting lineage-specific conservation patterns that might indicate specialized functional adaptations . Implement advanced homology modeling approaches that incorporate both sequence-based alignments and any available experimental structures from related proteins, paying particular attention to the quality of transmembrane region modeling through the use of specialized algorithms like MEDELLER that are optimized for membrane protein structural prediction . Apply molecular docking simulations to explore potential interactions between nuoK and its substrates (e.g., quinones) or cofactors, utilizing flexible docking protocols that allow for induced-fit effects and ensemble docking approaches that account for protein conformational diversity . Employ molecular dynamics simulations, particularly with specialized force fields optimized for membrane environments, to identify stable water channels, proton wire networks, and conformational changes that might be involved in the catalytic mechanism; extended simulations (>100 ns) are often necessary to observe functionally relevant motions in membrane proteins . Utilize Markov state modeling or other advanced sampling techniques to identify metastable states and transition pathways between them, helping to construct a comprehensive model of the catalytic cycle including potential rate-limiting steps . Implement quantum mechanics/molecular mechanics (QM/MM) calculations to model electron and proton transfer events with atomistic detail, particularly for regions containing potentially catalytic residues identified through conservation analysis . Apply co-evolution analysis using approaches such as direct coupling analysis (DCA) or statistical coupling analysis (SCA) to identify networks of co-evolving residues within nuoK that likely work together in substrate binding or catalysis, as functionally linked residues often show correlated evolutionary patterns . Finally, integrate these computational predictions with available experimental data through a Bayesian framework that weights different evidence sources based on their reliability, allowing iterative refinement of mechanistic models as new data becomes available . This comprehensive bioinformatic approach provides testable hypotheses about nuoK's substrate interactions and catalytic mechanisms that can guide subsequent experimental validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.