Recombinant Enterobacter sp. Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction and Functional Overview

The arnE gene encodes a subunit of an undecaprenyl-phosphate-α-L-Ara4N flippase, a membrane-bound enzyme critical for lipid A modification in Gram-negative bacteria. This enzyme facilitates the transport of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic face of the inner membrane . Recombinant ArnE proteins are engineered versions of this subunit, typically expressed in E. coli for research or therapeutic applications.

Recombinant Production and Biochemical Properties

Recombinant ArnE is produced via heterologous expression in E. coli, optimized for structural and functional studies:

  • Expression System: E. coli BL21(DE3) or similar strains .

  • Sequence Conservation: Full-length (1–111 aa) with conserved motifs for membrane integration .

  • Functional Assays: Used to study lipid A modification and polymyxin resistance mechanisms .

SpeciesUniProt IDAA Sequence Highlight
Enterobacter sp. (638)A4WAM0MSYVLIVFASLLSCGGQLCQKQAAHTRARQRVWGWLALSLVLLGCAMLLWLFVLQTVPVS
Shigella flexneriQ7UC61MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMMLWLLVLQN
Escherichia fergusoniiB7LM73MIWLVLILASLLSVTGQLCQKQATRPVAINKRRKHIALWLGLGLVCLGLAMVLWLLVLQT

Research Implications and Applications

ArnE’s role in antibiotic resistance and LPS biogenesis makes it a target for:

  • Antimicrobial Development: Inhibitors of ArnE/ArnF could restore polymyxin efficacy in resistant pathogens .

  • Structural Biology: Cryo-EM studies of the ArnE/ArnF complex to elucidate substrate translocation mechanisms .

  • Genomic Monitoring: Tracking arnE in clinical isolates like Enterobacter hormaechei ST133, linked to carbapenem and polymyxin resistance .

Key Research Findings

  1. Function in Antibiotic Resistance:

    • ArnE/ArnF mediates lipid A modification by adding L-Ara4N, reducing polymyxin binding affinity .

    • Deletion of arnE restores polymyxin sensitivity in resistant strains .

  2. Genomic Context:

    • Often co-located with carbapenemase genes (e.g., bla_KPC-2) on IncHI2 plasmids in Enterobacter sp. .

    • Virulence genes (e.g., iroBCDEN, iutAiucABCD) are frequently co-carried in arnE-positive strains .

  3. Recombinant Protein Utility:

    • ELISA kits and purified ArnE enable antibody development for diagnostic purposes .

    • Storage at -20°C/-80°C with glycerol (50% final concentration) preserves activity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; Ent638_2074; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
arnE
Target Protein Sequence
MSYVLIVFASLLSCGGQLCQKQAAHTRARQRVWGWLALSLVLLGCAMLLWLFVLQTVPVS VAYPMLSLNFIFITLAARFIWHEPIALRHGVGVLLIIVGIILLGGAA
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane, moving it from the cytoplasmic to the periplasmic side.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the arnE gene and what is its role in Enterobacter species?

The arnE gene is a critical component of the arn operon (also known as the pmr operon), which is necessary for the covalent modification of lipid A with the cationic 4-aminoarabinose moiety . In Enterobacter species, ArnE forms a heterodimeric complex with ArnF (PmrM/L), creating a flippase that transports bactoprenyl monophosphate-4-aminoarabinose (BP-Ara4N) from the cytoplasm to the periplasm . This transport mechanism is essential for the subsequent transfer of 4-aminoarabinose to lipid A by ArnT (PmrK), which reduces the negative charge of the bacterial outer membrane and contributes to resistance against cationic antimicrobial peptides and certain antibiotics .

Enterobacter species, as members of the Enterobacteriaceae family, are noted for their intrinsic resistance to β-lactam antibiotics and their remarkable ability to acquire additional resistance mechanisms . The arnE gene contributes significantly to this intrinsic resistance profile, particularly against polymyxins and other cationic antimicrobial compounds.

How does arnE contribute to the arn operon's function in lipopolysaccharide modification?

The arn operon orchestrates a multi-step biochemical pathway for the modification of lipopolysaccharide (LPS) with 4-aminoarabinose. ArnE plays a specific and crucial role within this pathway by facilitating the translocation of modified lipid precursors across the cytoplasmic membrane.

GeneProteinFunction in LPS Modification
arnAArnABifunctional enzyme: oxidative decarboxylation and formylation reactions
arnBArnBTransamination to generate 4-amino-4-deoxy-L-arabinose precursor
arnCArnCTransfer of 4-formamido-arabinose to bactoprenyl phosphate
arnDArnD/PmrJDeformylation of BP-Ara4FN to BP-Ara4N
arnEArnE/PmrMComponent of flippase heterodimer
arnFArnF/PmrLComponent of flippase heterodimer
arnTArnT/PmrKTransfers Ara4N from BP-Ara4N to lipid A

The pathway begins with cytoplasmic synthesis steps involving ArnA, ArnB, and ArnC, resulting in the production of bactoprenyl monophosphate-4-formamido-arabinose (BP-Ara4FN) . ArnD then deformylates this intermediate to produce BP-Ara4N . At this critical juncture, the ArnE/F heterodimeric flippase translocates BP-Ara4N to the periplasmic side of the membrane, where ArnT can access it to transfer the 4-aminoarabinose moiety to lipid A . The deformylation step by ArnD likely commits the pathway to lipid A modification and prevents reversal of earlier reactions .

What evolutionary pressures have shaped arnE conservation in Enterobacteriaceae?

Evolutionary pressures on arnE stem primarily from constant exposure to host defense mechanisms and antimicrobial compounds. The Enterobacteriaceae family, including Enterobacter species, frequently colonizes the human gut microbiome and must adapt to survive host immune responses . The modification of LPS with 4-aminoarabinose provides a critical defense mechanism against cationic antimicrobial peptides produced by the host.

Clinical and genomic studies have revealed the striking facility of Enterobacter cloacae complex to acquire genes encoding broad-spectrum antibiotic resistance . This acquisition capacity operates alongside intrinsic resistance mechanisms, including those conferred by the arn operon. The widespread presence of the arn operon across Enterobacteriaceae suggests strong selective pressure to maintain this resistance mechanism.

The ecological dynamics of Enterobacteriaceae in the human gut microbiome further influence the evolution of arnE . Competition with other microbial species in this environment may drive the optimization of resistance mechanisms to maintain colonization advantage. Additionally, the frequent exposure to antibiotics in clinical settings has likely accelerated the selection for efficient LPS modification systems, including optimally functioning ArnE/F flippase complexes.

What molecular techniques are most effective for characterizing the arnE gene in Enterobacter species?

Several complementary molecular approaches provide comprehensive characterization of the arnE gene in Enterobacter species:

Genomic Analysis Techniques:

  • Whole-genome sequencing (WGS) combined with comparative genomics has facilitated global analyses of clonal composition of Enterobacter cloacae complex and identification of resistance determinants . This approach provides the genomic context of arnE and reveals its relationship with other resistance genes.

  • Multilocus sequence typing (MLST) has enabled the identification of over 1069 ECC sequence types in 18 phylogenetic clusters across the globe , helping to place arnE variants in their evolutionary context.

  • PCR amplification and Sanger sequencing remain valuable for targeted analysis of arnE sequences, particularly for verification of genetic constructs and mutants .

Functional Characterization Methods:

  • Gene knockout studies using CRISPR-Cas9 systems similar to those described for phage engineering can be adapted to generate ΔarnE mutants, allowing functional assessment through phenotypic analysis.

  • Complementation studies reintroducing wild-type or modified arnE can confirm gene function and identify critical residues.

  • High-resolution metagenomic analysis, as employed for studying Enterobacteriaceae in the human microbiome, can reveal the prevalence and expression patterns of arnE in complex bacterial communities .

Expression Analysis Approaches:

  • Quantitative PCR (qPCR) for measuring arnE transcript levels under various conditions.

  • RNA sequencing (RNA-seq) for genome-wide transcriptional profiling, revealing co-regulated genes and regulatory networks.

  • Reporter gene fusions (e.g., arnE promoter-luciferase constructs) for monitoring gene expression in real-time response to environmental stimuli.

The integration of these techniques provides comprehensive insights into arnE sequence variation, expression patterns, and functional significance in antimicrobial resistance.

How can recombinant ArnE protein be expressed and purified for functional studies?

The expression and purification of recombinant ArnE presents significant challenges due to its nature as a membrane protein. A methodological approach based on established membrane protein techniques can be implemented:

Expression System Selection:

  • Utilize specialized E. coli strains designed for membrane protein expression, such as C41(DE3), which has been successfully employed for the expression of the related membrane protein ArnT .

  • Consider co-expression with ArnF to promote proper folding and stability of the heterodimeric complex.

  • Engineer expression constructs with affinity tags (e.g., 6xHis-tag) to facilitate purification while minimizing interference with protein function .

Optimization of Expression Conditions:

  • Test various induction parameters including temperature (typically lower temperatures of 16-25°C), inducer concentration, and duration to maximize properly folded protein yield.

  • Supplement growth media with additives that enhance membrane protein expression, such as specific carbon sources or osmolytes.

Membrane Extraction and Solubilization:

  • Isolate membrane fractions through differential centrifugation following cell lysis.

  • Screen a panel of detergents (e.g., n-dodecyl-β-D-maltopyranoside, lauryl maltose neopentyl glycol) to identify optimal conditions for ArnE solubilization while preserving native structure and function.

  • Consider bicelle or nanodisc systems for maintaining a more native-like lipid environment.

Purification Strategy:

  • Implement multi-step purification beginning with affinity chromatography (Ni-NTA for His-tagged constructs).

  • Employ size exclusion chromatography to separate properly assembled ArnE/F complexes from aggregates and individual subunits.

  • Consider ion exchange chromatography for further purification if needed.

Functional Verification:

  • Develop assays to confirm ArnE activity, potentially adapting the ESI-LC-MS analysis method used to detect BP-Ara4N formation in reconstituted systems .

  • Assess protein-protein interactions between ArnE and ArnF using techniques such as co-immunoprecipitation or crosslinking studies.

This systematic approach addresses the challenges inherent in membrane protein biochemistry while maximizing the likelihood of obtaining functionally active recombinant ArnE for detailed mechanistic studies.

What are the challenges in studying the ArnE/ArnF flippase heterodimer in vitro?

Investigating the ArnE/ArnF flippase heterodimer presents several significant technical challenges that must be addressed for successful functional studies:

Membrane Protein Stability and Solubilization:
The primary challenge lies in maintaining the native structure and function of these integral membrane proteins during extraction from the lipid bilayer. The search results highlight "limitations in procuring and detecting native BP-linked substrates" as a major obstacle . Detergent selection is critical, as inappropriate solubilization conditions can lead to protein denaturation or disruption of the heterodimeric interface.

Reconstitution of Functional Complexes:
The ArnE/ArnF heterodimer must be correctly assembled to function properly. Ensuring proper stoichiometry and orientation during reconstitution into artificial membrane systems (liposomes, nanodiscs, or bicelles) presents significant challenges. The functional complex likely requires specific lipid compositions that mimic the native bacterial membrane environment.

Substrate Accessibility:
The natural substrate of the ArnE/ArnF flippase, bactoprenyl monophosphate-4-aminoarabinose (BP-Ara4N), is not commercially available and must be enzymatically synthesized. Recent work has demonstrated the utility of "fluorescent bactoprenyl" analogs, which may provide alternative approaches for activity assays .

Development of Robust Activity Assays:
Detecting flippase activity requires sophisticated analytical methods. The research has utilized ESI-LC-MS analysis to detect BP-Ara4N formation in reconstituted systems , but establishing high-throughput assays remains challenging. The directional nature of flippase activity (cytoplasm to periplasm) further complicates in vitro assay design.

Structural Characterization:
Obtaining high-resolution structural information through X-ray crystallography or cryo-electron microscopy presents additional hurdles due to the dynamic nature of membrane proteins and the challenges in forming well-ordered crystals. Computational approaches may help bridge these gaps but require experimental validation.

These technical challenges explain why the ArnE/ArnF complex is still described as a "proposed flippase heterodimer" , highlighting the need for innovative methodological approaches to fully characterize its structure and mechanism.

How does the ArnE/ArnF flippase contribute to polymyxin resistance in Enterobacter species?

The ArnE/ArnF flippase heterodimer plays a critical role in polymyxin resistance through its function in the lipopolysaccharide (LPS) modification pathway. This contribution can be understood in terms of both its biochemical mechanism and its place within the broader context of antimicrobial resistance strategies:

Biochemical Mechanism of Resistance:
The ArnE/ArnF heterodimer transports bactoprenyl monophosphate-4-aminoarabinose (BP-Ara4N) from the cytoplasm to the periplasm . This translocation is essential for the subsequent transfer of the 4-aminoarabinose moiety to lipid A by ArnT, which reduces the negative charge of the bacterial outer membrane . Polymyxins and other cationic antimicrobial peptides initially bind to the negatively charged phosphate groups on lipid A through electrostatic interactions. The addition of the positively charged 4-aminoarabinose neutralizes these negative charges, significantly reducing polymyxin binding affinity and preventing membrane disruption.

Resistance MechanismTarget AntimicrobialsRole of ArnE/F
LPS modification with Ara4NPolymyxins, cationic antimicrobial peptidesEssential for BP-Ara4N translocation
β-lactamase productionβ-lactamsNone directly
Carbapenemase productionCarbapenemsNone directly
Efflux pumpsMultiple classesNone directly
Porin alterationsMultiple classesNone directly

Integration with Other Resistance Mechanisms:
In Enterobacter species, the action of the ArnE/ArnF flippase complements other intrinsic resistance mechanisms. The Enterobacter cloacae complex exhibits "a unique ability to acquire genes encoding resistance to multiple classes of antibiotics, including a variety of carbapenemase genes, superimposed on intrinsic β-lactam resistance" . This creates a layered defense strategy where multiple mechanisms operate simultaneously to provide broad-spectrum resistance.

Clinical Significance:
The emergence of polymyxin resistance is particularly concerning as polymyxins (especially colistin) often serve as last-resort antibiotics for multidrug-resistant Gram-negative infections. The increasing prevalence of carbapenem-resistant Enterobacter cloacae complex (CREC) has led to renewed interest in understanding resistance mechanisms like those mediated by the arn operon .

The essential role of ArnE/F in this pathway makes it a potential target for adjuvant therapies that could restore polymyxin susceptibility in resistant Enterobacter isolates.

What is the relationship between arnE expression and multidrug resistance in clinical Enterobacter isolates?

The relationship between arnE expression and multidrug resistance (MDR) in clinical Enterobacter isolates is multifaceted, involving both direct and indirect connections:

Co-regulation with Other Resistance Determinants:
In clinical isolates of Enterobacter cloacae complex, arnE expression often correlates with broader MDR phenotypes. This relationship stems from coordinated regulation of multiple resistance mechanisms. Two-component regulatory systems that activate the arn operon in response to environmental signals (such as PmrA/PmrB and PhoP/PhoQ) frequently regulate other resistance determinants simultaneously. This creates a situation where arnE upregulation serves as a marker for activation of multiple resistance pathways.

Contribution to Survival Under Antibiotic Pressure:
While the ArnE/F flippase primarily contributes to resistance against polymyxins and cationic antimicrobial peptides, this resistance can indirectly support survival during treatment with other antibiotic classes. By enabling bacterial persistence during combination therapy that includes polymyxins, the arn system provides an opportunity for the bacteria to express or acquire additional resistance mechanisms.

Role in Stress Response:
Expression of arnE and other arn operon genes increases in response to various stressors encountered in clinical environments. This general stress response enhances survival under adverse conditions, including those created by antibiotic treatments, providing a link between environmental adaptation and multidrug resistance.

Understanding the relationship between arnE expression and MDR phenotypes provides valuable insights for developing strategies to combat antimicrobial resistance in Enterobacter species. Monitoring arnE expression levels could potentially serve as a biomarker for predicting broader resistance profiles in clinical isolates.

Can arnE be targeted to restore antibiotic susceptibility in resistant Enterobacter strains?

Targeting arnE represents a promising strategy for restoring antibiotic susceptibility in resistant Enterobacter strains, particularly for polymyxins. Several potential approaches and their feasibility are discussed below:

Small Molecule Inhibitors:
Development of small molecule inhibitors that specifically target ArnE function could block the translocation of BP-Ara4N to the periplasm, preventing the 4-aminoarabinose modification of lipid A. Such inhibitors could act as antibiotic adjuvants when administered alongside polymyxins. Potential targets include:

  • The ArnE/ArnF interaction interface to prevent heterodimer formation

  • The substrate binding site to block BP-Ara4N recognition

  • Conserved residues essential for the conformational changes during flippase activity

Genetic Approaches:
CRISPR-Cas9 systems similar to those described for phage engineering could potentially be adapted to specifically target and inactivate the arnE gene in clinical isolates. This approach faces delivery challenges but could be effective in combination with phage therapy or other nucleic acid delivery systems.

Peptide-Based Strategies:
Engineered peptides that mimic critical regions of ArnE or ArnF could interfere with heterodimer assembly or function. These competitive inhibitors could be designed based on structural information about the ArnE/F complex interaction domains.

Alternative Pathway Targeting:
Inhibiting other components of the arn pathway, such as ArnT or ArnC, could indirectly neutralize the contribution of ArnE to antimicrobial resistance. An experimental approach demonstrated in research involved using ΔarnC membrane fractions to study BP-Ara4N formation , suggesting that targeting ArnC could be effective in disrupting the pathway.

Challenges and Considerations:
Several factors complicate the development of arnE-targeting therapeutics:

  • Potential effects on commensal bacteria that also possess the arn operon

  • The need for highly specific inhibitors to avoid off-target effects

  • The challenge of delivering inhibitors across the Gram-negative outer membrane

  • The potential for resistance to develop against such inhibitors

Despite these challenges, the critical role of ArnE in polymyxin resistance makes it an attractive target for adjuvant therapy, particularly for multidrug-resistant Enterobacter species where treatment options are severely limited.

What structural features of ArnE are critical for its function as part of a flippase complex?

Although detailed structural information for ArnE is currently limited, several critical structural features can be inferred from its function as a flippase component and from related membrane transporters:

Transmembrane Domain Architecture:
As an integral membrane protein, ArnE likely contains multiple transmembrane helices that span the cytoplasmic membrane. These helices are predicted to form a hydrophilic pathway or pore through which the polar head group of BP-Ara4N can pass while keeping the hydrophobic bactoprenyl tail within the membrane environment. The arrangement of these transmembrane domains creates an amphipathic pathway that accommodates the chemical nature of the substrate.

Substrate Recognition Elements:
Specific regions within ArnE must recognize and bind the 4-aminoarabinose moiety of BP-Ara4N. These substrate-binding domains likely include polar or charged amino acid residues that form hydrogen bonds or electrostatic interactions with the substrate. The specificity of this recognition is critical for ensuring that only the appropriate substrate is translocated.

ArnF Interaction Interface:
The formation of a heterodimer with ArnF is essential for flippase function . The protein-protein interaction surfaces likely involve complementary regions on both proteins that form specific contacts. These interfaces may include coiled-coil domains, complementary charged surfaces, or specific recognition motifs that ensure proper assembly of the functional heterodimer.

Conformational Switching Mechanism:
Like other transporters, ArnE/F likely undergoes substantial conformational changes during the flipping process. These conformational changes would alternately expose the substrate-binding site to the cytoplasmic and periplasmic faces of the membrane. Flexible hinge regions or dynamic domains within the protein structure would facilitate these movements.

Energy Coupling Domains:
The translocation of BP-Ara4N against a concentration gradient likely requires energy. ArnE may contain domains that couple the flipping process to energy sources such as ATP hydrolysis or the proton motive force. These could include nucleotide-binding domains or residues that participate in proton relay networks.

Elucidating these structural features through techniques such as cryo-electron microscopy or X-ray crystallography would significantly advance our understanding of ArnE function and potentially facilitate the design of specific inhibitors targeting this critical resistance determinant.

How does the interaction between ArnE and ArnF facilitate the flipping of bactoprenyl-linked substrates?

The interaction between ArnE and ArnF creates a specialized molecular machinery that facilitates the translocation of bactoprenyl-linked substrates across the bacterial membrane. The mechanistic details of this process likely involve:

Complementary Functional Domains:
ArnE and ArnF likely contribute complementary functional elements to the heterodimeric complex. Together, they form a complete translocation pathway that cannot be achieved by either protein alone. This functional complementarity enables the creation of a hydrophilic channel through which the polar 4-aminoarabinose moiety can pass, while maintaining interactions with the hydrophobic bactoprenyl tail.

Conformational Cycling:
The heterodimer almost certainly operates through an alternating access mechanism, where coordinated conformational changes expose the substrate-binding site alternately to the cytoplasmic and periplasmic sides of the membrane. This conformational cycling would involve:

  • Recognition and binding of BP-Ara4N on the cytoplasmic face

  • Occlusion of the substrate within the protein complex

  • Conformational shift to expose the substrate to the periplasmic side

  • Release of the substrate to the periplasmic leaflet

Substrate Recognition Partitioning:
One interesting possibility is that ArnE and ArnF may specialize in recognizing different portions of the BP-Ara4N substrate. For example, one subunit might primarily interact with the bactoprenyl moiety while the other recognizes the 4-aminoarabinose group. This partitioning would ensure highly specific substrate recognition.

Energy Transduction:
The heterodimeric structure likely creates binding sites for energy sources or establishes proton channels that couple the flipping process to energy sources such as the proton motive force. The interaction between ArnE and ArnF could create composite binding sites that neither protein possesses independently.

Membrane Deformation:
The ArnE/F complex may locally deform the membrane to facilitate flipping of the large bactoprenyl-linked substrate. This deformation could reduce the energy barrier for moving the polar head group through the hydrophobic membrane interior.

Research has demonstrated that membrane fractions containing ArnT (and presumably ArnE/F) can catalyze the formation of BP-Ara4N when incubated with appropriate substrates . This functional reconstitution provides evidence for the essential role of the ArnE/F heterodimer in the flipping process, though the precise molecular mechanism remains to be fully elucidated.

What regulatory mechanisms control arnE expression in response to environmental signals?

The expression of arnE is tightly regulated by sophisticated molecular mechanisms that respond to environmental signals, enabling bacteria to adapt their antimicrobial resistance profile to changing conditions:

Two-Component Regulatory Systems:
The primary regulators of arnE expression are two-component systems that sense environmental conditions and transduce these signals to alter gene expression. Based on established patterns in Enterobacteriaceae, key systems likely include:

  • PmrA/PmrB System: This system responds to high Fe3+ concentrations, acidic pH, and certain antimicrobial peptides. When activated, the PmrB sensor kinase phosphorylates the PmrA response regulator, which binds to promoter regions of the arn operon to activate transcription.

  • PhoP/PhoQ System: This system senses low Mg2+ concentrations, acidic pH, and antimicrobial peptides. Activated PhoP can directly upregulate the arn operon or act indirectly through activation of PmrD, which protects phosphorylated PmrA from dephosphorylation.

Cross-Regulation and Signal Integration:
The regulatory network controlling arnE expression exhibits significant cross-talk between different signaling pathways, allowing integration of multiple environmental cues:

  • PhoP-activated PmrD can post-translationally regulate the PmrA/PmrB system

  • Additional regulators like RcsB can influence arn operon expression

  • Global regulators such as H-NS may repress arn expression under non-inducing conditions

Feedback Mechanisms:
The arn pathway likely incorporates feedback regulation to fine-tune expression levels:

  • Altered membrane properties resulting from LPS modification may affect sensor kinase activity

  • Accumulation of pathway intermediates may influence regulatory protein activity

  • Changes in cellular metabolism due to arn operon expression may trigger compensatory responses

Post-Transcriptional Control:
Beyond transcriptional regulation, arnE expression may be subject to post-transcriptional mechanisms:

  • Small regulatory RNAs (sRNAs) may influence mRNA stability or translation efficiency

  • RNA thermosensors could modulate translation in response to temperature changes

  • Riboswitches might respond to specific metabolites related to cell envelope stress

The Enterobacter cloacae complex demonstrates "a unique ability to acquire genes encoding resistance to multiple classes of antibiotics" , suggesting that arnE regulation may be particularly adaptive in these species. Understanding the precise regulatory mechanisms controlling arnE expression could identify points of intervention to modulate antimicrobial resistance.

How conserved is the arnE gene sequence across different Enterobacteriaceae species?

The arnE gene shows notable conservation across Enterobacteriaceae, reflecting its essential role in antimicrobial resistance, though with important variations that may influence function in different species:

Sequence Conservation Patterns:
Based on comparative genomic analyses of Enterobacteriaceae, arnE displays a pattern of conservation characteristic of genes under purifying selection, with greater conservation in functional domains and more variation in non-critical regions. Molecular typing methods that have identified over 1069 Enterobacter cloacae complex sequence types in 18 phylogenetic clusters globally provide a framework for understanding this diversity .

SpeciesEstimated arnE Coding Sequence Identity (%)Estimated Protein Similarity (%)Functional Domain Conservation
Enterobacter cloacae complex88-10090-100High in transmembrane and substrate-binding domains
Klebsiella pneumoniae80-8885-90High in functional domains
Escherichia coli75-8580-88Conserved in critical residues
Salmonella enterica78-8682-89High in ArnF interaction regions

Functional Implications of Variation:
Sequence variations observed across species likely reflect adaptation to different ecological niches and host environments. Enterobacteriaceae occupy diverse habitats ranging from the human intestinal microbiome to environmental reservoirs, and these different selective pressures may drive species-specific adaptations in arnE. Variations may affect:

  • Substrate specificity or affinity

  • Efficiency of translocation

  • Interaction strength with ArnF

  • Regulatory responsiveness

Evolutionary Context:
The distribution and conservation of arnE must be understood in the context of horizontal gene transfer and the acquisition of resistance determinants. Enterobacter species show "a striking facility for acquiring genes encoding resistance to multiple classes of antibiotics" , suggesting that the arn operon may be part of mobile genetic elements in some cases, while being core genomic components in others.

Metagenomic Insights:
High-resolution metagenomic analyses of human gut microbiomes have revealed patterns in the distribution and abundance of Enterobacteriaceae genes . These approaches can elucidate the presence and variation of arnE in complex microbial communities, providing population-level insights into its conservation and diversity.

The conservation patterns of arnE provide valuable information for designing broad-spectrum inhibitors targeting this resistance mechanism across multiple pathogenic species within the Enterobacteriaceae family.

What can comparative genomics reveal about the evolution of arnE in antibiotic-resistant Enterobacteriaceae?

Comparative genomics offers powerful insights into the evolutionary trajectory of arnE in antibiotic-resistant Enterobacteriaceae, revealing patterns of selection, adaptation, and genetic exchange:

Evolutionary Origins and Selective Pressures:
Comparative genomic analyses across Enterobacteriaceae reveal that arnE is subject to both purifying selection (maintaining function) and diversifying selection (adapting to new conditions). By examining the ratio of synonymous to non-synonymous mutations across different lineages, researchers can identify regions under positive selection that may confer enhanced resistance or functional advantages.

The evolution of arnE must be understood in the context of the "global expansion of carbapenem-resistant E. cloacae complex" , where increasing antibiotic pressure has likely accelerated the evolution of resistance mechanisms, including LPS modifications.

Horizontal Gene Transfer and Resistance Islands:
Comparative genomics reveals evidence of horizontal gene transfer involving the arn operon in some Enterobacteriaceae. Genomic and epidemiological studies have identified "diverse multidrug-resistant ECC clones including several potential epidemic lineages" , suggesting that successful resistance determinants may spread horizontally as well as vertically.

Analysis of the genomic context of arnE can identify its association with mobile genetic elements or resistance islands. In some cases, the arn operon may be located within genomic islands with atypical GC content or flanked by insertion sequences or transposons, indicating acquisition through horizontal transfer.

Co-evolution with Other Resistance Mechanisms:
The arnE gene likely co-evolves with other resistance determinants. Enterobacter species exhibit "a unique ability to acquire genes encoding resistance to multiple classes of antibiotics, including a variety of carbapenemase genes, superimposed on intrinsic β-lactam resistance" . This suggests coordinated evolution of multiple resistance mechanisms creating effective resistance combinations.

Ecological Context and Host Adaptation:
The ecological dynamics of Enterobacteriaceae in the human gut microbiome provide crucial context for understanding arnE evolution . Comparative genomics can reveal whether different variants of arnE are associated with specific host environments or clinical outcomes. Machine learning analyses have identified "a robust gut microbiome signature associated with Enterobacteriaceae colonization status, consistent across health states and geographic locations" , suggesting that specific genetic profiles may confer advantages in colonization.

Implications for Resistance Surveillance and Control: The evolutionary patterns revealed by comparative genomics have important implications for tracking and controlling antimicrobial resistance. Identifying conserved regions of arnE that are essential for function could guide the development of broad-spectrum inhibitors targeting this resistance mechanism across multiple Enterobacteriaceae species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.