Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnF; Ent638_2073; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Protein Sequence
MMGYFWALMSVLLVSGAQLMMKWAMVSLPPVGQTDALMSAFMSVTPGAVALVIGLFAYVF
SMGCWYMALRRIALSKAYPLLSLSYVLVWAAAIGLPWLHEPFSVGKLAGVSVIFVGLLLV
CLPDKKS