Recombinant Enterobacter sp. Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please include your request in the order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
lgt; Ent638_3270; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
lgt
Target Protein Sequence
MNSGYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLAGRRAGRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPTFLSDPLYLFRVWDGGMSFHGGLIGVILVMVIFAKRT KRNFFQVADFMAPLIPFGLGAGRLGNFINGELWGRVDPSVPYTMLFPASRAEDIALLPSH PEWQSIFDTYGVLPRHMSQLYELALEGVVLFIILNLFIRKPRPMGSVSGLFLIGYGAFRI IVEFFRQPDAQFTGEWVQYISMGQILSIPMIVAGIIMMIWAYRRPQQQLS
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Lgt in Enterobacter species?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway essential for bacterial lipoprotein biogenesis. In Enterobacter species, as in other Gram-negative bacteria, Lgt transfers the diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the conserved lipobox sequence of pre-prolipoproteins . The enzyme is anchored in the inner membrane via multiple transmembrane domains, with crystal structures of the related E. coli Lgt revealing a complex topology that accommodates lateral entry of substrates from the lipid bilayer .

The functional significance of Lgt cannot be overstated, as deletion of the lgt gene is lethal to most Gram-negative bacteria, including Enterobacter species . The essential nature of this enzyme makes it an attractive target for antimicrobial development, particularly since even modest depletion of Lgt (approximately 25%) has been shown to cause significant loss of bacterial viability .

How are conserved domains organized in Enterobacter sp. Lgt?

Enterobacter sp. Lgt contains several highly conserved domains that are critical for its function, with recent research identifying two principal structural components: the arm domain and the head domain . The organization of these domains is crucial for substrate recognition and catalytic activity.

The transmembrane segments form the core structure, with TM-1 through TM-7 creating a scaffold that positions essential catalytic residues. Between these transmembrane segments, connecting loops form functional domains that participate in substrate binding and catalysis. Particularly noteworthy is the periplasmic head domain, which recent studies have shown is important for proper Lgt function .

Several essential residues have been identified in closely related E. coli Lgt, including sixteen that are completely conserved across pathogenic species. These include Y26 in TM-1, H103 in TM-3, R143 and N146 in TM-4, G154 in the loop between TM-4 and the head domain, and R239 in TM-6 . These residues are likely conserved in Enterobacter sp. Lgt as well, given the high sequence similarity among Enterobacteriaceae.

What expression systems are recommended for recombinant Enterobacter sp. Lgt production?

For successful production of recombinant Enterobacter sp. Lgt, researchers should consider membrane protein expression systems that accommodate the complex topology of this integral membrane enzyme. E. coli expression systems have been successfully used for related Lgt proteins, with inducible promoters allowing controlled expression.

Complementation studies have demonstrated that E. coli strains with deleted chromosomal lgt can be successfully complemented with lgt genes from various species, including Pseudomonas aeruginosa and Acinetobacter baumannii, despite sequence identities of only 51.6% and 48.6%, respectively . This suggests that heterologous expression systems can be viable options for Enterobacter sp. Lgt.

For structural studies, expression conditions must be carefully optimized. The crystal structures of E. coli Lgt were determined at resolutions of 1.9 Å and 1.6 Å using protein that was purified and crystallized under specific conditions . Similar approaches could be applied to Enterobacter sp. Lgt, potentially using vapor-diffusion crystallization methods with polyethylene glycol as a precipitant at alkaline pH, as has been successful for other bacterial membrane proteins .

How do mutations in conserved residues affect Lgt activity in Enterobacter species?

Mutational analysis of conserved residues provides crucial insights into the structure-function relationship of Lgt. Based on complementation studies in E. coli, which is closely related to Enterobacter, several critical amino acids have been identified that when mutated severely compromise enzyme function .

The following table summarizes the effect of various mutations on Lgt function based on complementation studies:

MutationLocationEffect on GrowthFunctional Impact
Y26ATM-1No growthNon-functional, causes cell lysis
G98ABetween arm-2 and TM-3Delayed growthPartially functional
G104ATM-3Delayed growthPartially functional
H103QTM-3Growth to mid-exponential phaseNon-functional, causes cell lysis
R143ATM-4No growthNon-functional, causes cell lysis
N146ATM-4No growthNon-functional, causes cell lysis
E151ALoop between TM-4 and headDelayed growthPartially functional
G154ALoop between TM-4 and headNo growthNon-functional, causes cell lysis
D129ANot specifiedNormal growthFully functional
R239ATM-6No growthNon-functional, causes cell lysis
E243ANot specifiedNormal growthFully functional

The critical residues Y26, H103, R143, N146, G154, and R239 have been confirmed as essential for Lgt function . Mutations at these positions result in non-functional enzymes that cannot support bacterial growth, even in strains where the normally lethal effects of lgt deletion are mitigated by concurrent deletion of lpp (DlgtDlpp strains) .

For researchers studying Enterobacter sp. Lgt, site-directed mutagenesis targeting these conserved residues would be a logical approach to probe enzyme mechanism and identify potential species-specific functional differences.

What structural features determine substrate specificity of Enterobacter Lgt?

Crystal structures of E. coli Lgt have revealed two distinct binding sites that contribute to substrate specificity . These structural insights, which likely apply to Enterobacter sp. Lgt given their phylogenetic proximity, demonstrate how the enzyme accommodates both phosphatidylglycerol and the lipobox-containing peptide.

The arm and head domains play crucial roles in determining functional diversity among bacterial pathogens . The arm domain, consisting of several transmembrane segments, creates a hydrophobic environment suitable for lipid substrate binding. The head domain, meanwhile, is likely involved in recognizing the amino acid sequence of the lipobox motif.

Recent complementation studies have demonstrated that chimeric Lgt proteins with head domains from different bacterial species show varying abilities to restore growth in lgt-knockout cells . This suggests that the head domain is a key determinant of substrate specificity and functional adaptation across bacterial species.

Researchers investigating Enterobacter sp. Lgt specificity should consider experimental approaches that combine structural analysis with biochemical assays. A GFP-based in vitro assay has been successfully used to correlate Lgt activities with structural observations , providing a methodology that could be adapted for studies of Enterobacter sp. Lgt substrate specificity.

How can partial inhibition of Lgt be achieved and quantified in experimental settings?

Partial inhibition of Lgt represents an attractive approach for antimicrobial development, as even modest depletion has been shown to significantly impact bacterial viability . Several experimental strategies can be employed to achieve and measure partial Lgt inhibition.

One effective approach is conditional expression using arabinose-inducible promoters. Researchers have engineered strains where the only copy of lgt is under the control of an arabinose-inducible promoter, allowing precise control of expression levels . By varying arabinose concentrations, a dose-dependent depletion of Lgt can be achieved, with corresponding effects on bacterial viability and accumulation of unmodified prolipoprotein (UPLP) .

Quantification of Lgt inhibition can be performed through multiple complementary methods:

  • Western blotting to measure Lgt protein levels

  • Detection of unmodified prolipoprotein accumulation

  • Bacterial viability assays (CFU counts)

  • Membrane integrity assays using dyes like SYTOX green

  • Antibiotic sensitivity testing

Research has shown that as little as 25% depletion of Lgt is sufficient for loss of cell viability, while cells expressing approximately 90% of normal Lgt levels show increased sensitivity to complement-mediated killing and membrane permeability changes . This establishes useful parameters for researchers designing inhibition studies.

For biochemical inhibition studies, structurally characterized inhibitors like palmitic acid can serve as starting points . Crystal structures of E. coli Lgt in complex with this inhibitor at 1.6 Å resolution provide valuable information for rational design of Enterobacter sp. Lgt inhibitors.

What methodological approaches can measure the lateral movement of substrates in Lgt?

The mechanism of Lgt involves lateral entry and exit of substrates and products relative to the lipid bilayer . Investigating this unique aspect of Lgt function requires specialized experimental approaches.

Molecular dynamics simulations based on crystal structures can model the lateral movement of substrates through the membrane-embedded regions of Lgt. These computational approaches should incorporate the known topology of transmembrane segments and the orientation of catalytic residues.

Biochemically, fluorescently labeled lipobox-containing peptides can be used in combination with reconstituted proteoliposomes containing purified Lgt to track substrate movement. FRET-based assays could potentially measure the transfer of lipid-modified peptide from the enzyme to the membrane.

Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy represents another powerful approach to study dynamic aspects of substrate movement within the membrane environment. By strategically placing spin labels at positions predicted to interact with the substrate during its lateral movement, researchers can obtain distance measurements and conformational information.

How does the horizontal gene transfer influence the evolution of Lgt in Enterobacteriaceae?

While not directly related to Lgt enzyme function, the evolution of bacterial genes through lateral gene transfer (LGT) has significant implications for understanding the diversity of Lgt across Enterobacteriaceae, including Enterobacter species.

Studies of O-antigen gene clusters in Enterobacteriaceae have demonstrated that these genetic loci are subject to strong frequency-dependent selection and can be transferred between species . The divergence in G+C content observed in some genetic loci suggests relatively recent acquisition through LGT .

While specific information about LGT involving the lgt gene itself was not provided in the search results, the high conservation of essential residues across pathogenic species (16 completely conserved residues among 22 Lgt proteins) suggests selective pressure to maintain functionality while allowing adaptation to different bacterial environments.

Researchers interested in the evolutionary aspects of Enterobacter sp. Lgt should consider comparative genomic approaches to identify potential horizontal gene transfer events. Analysis of G+C content, codon usage bias, and phylogenetic incongruence can provide evidence of LGT. Additionally, examination of flanking sequences and mobile genetic elements may reveal mechanisms of gene transfer.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.