Recombinant Enterobacter sp. Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; Ent638_1160; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWFLSMRFNPMHQAIPLGTLTANLIGAFIIGVGLAWFNRMTH IDPMWKLLITTGFCGGLTTFSTFSAEVVFLLQDGRINWALANIAVNMLGSFAMTALAFWL FSAASAH
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is CrcB and what is its primary function in Enterobacter species?

CrcB is a membrane protein that functions primarily as a fluoride transporter in bacterial species including Enterobacter. It belongs to a superfamily predominantly composed of transporters and plays a critical role in fluoride resistance by reducing cellular concentrations of this anion .

The importance of CrcB in fluoride resistance is demonstrated through knockout studies where E. coli strains lacking the crcB gene could not grow at 50 mM fluoride and exhibited high reporter gene expression even at low fluoride concentrations (0.2 mM) . This protective function is particularly relevant given that fluoride can be toxic to bacterial cells at certain concentrations.

How is the crcB gene organized within the Enterobacter genome?

In Enterobacter cloacae FRM, the crcB gene is part of an operon arrangement with several other genes. RT-PCR experiments have demonstrated that gpmA, crcB, and orf5249 are co-transcribed as a single operon . This genomic organization is distinct from another nearby operon consisting of ppaC, uspA, and eno genes .

This operonic arrangement allows for coordinated expression of these genes, which may collectively contribute to fluoride resistance mechanisms. The genomic context suggests functional relationships between these co-expressed genes, providing insights into the broader fluoride resistance network in Enterobacter species.

What mechanisms regulate crcB expression in bacterial species?

The expression of crcB is regulated by fluoride-sensing RNA structures called riboswitches. These fluoride riboswitches undergo structural changes upon binding fluoride, with an apparent dissociation constant (KD) of approximately 60 μM . This regulatory mechanism allows bacteria to detect and respond to environmental fluoride levels.

When exposed to fluoride, expression of the gpmA-crcB-orf5249 operon in E. cloacae FRM increases approximately 10-fold, as confirmed by both RNA-seq and qRT-PCR analyses . This upregulation enables the bacteria to enhance their fluoride resistance mechanisms when exposed to this toxic anion.

What approaches are most effective for creating and validating crcB knockout mutants?

For researchers seeking to generate crcB knockout mutants in Enterobacter species, the following methodological approach has proven effective:

  • Gene targeting strategy: Multiple approaches have been used to delete crcB in E. cloacae FRM, including individual gene deletions and deletion of entire gene clusters (e.g., Is3G-1 fragment containing orf5249, crcB, and gpmA) .

  • Verification methods: Knockout strains should be verified using PCR to confirm the deletion of the target gene . This verification step is critical to ensure that phenotypic changes can be attributed to the specific gene deletion.

  • Phenotypic assessment: Fluoride resistance can be evaluated by:

    • Growth on solid media containing fluoride (e.g., testing growth on Bulk plates with 1,000 mg/L fluoride)

    • Determining minimum inhibitory concentration (MIC) in liquid medium (e.g., comparing MICs between wild-type and knockout strains)

    • Measuring growth kinetics at various fluoride concentrations

The methodology should include appropriate controls, such as complementation experiments to confirm that the observed phenotype is specifically due to crcB deletion.

How can researchers accurately measure fluoride resistance in bacteria expressing CrcB?

Based on methods described in the literature, several complementary approaches are recommended:

  • Minimum Inhibitory Concentration (MIC) determination:

    • Systematically test growth in media containing increasing concentrations of fluoride

    • For E. cloacae FRM, MIC testing revealed high fluoride resistance (MIC of 2,500 mg/L for certain deletion strains, with wild-type having even higher resistance)

  • Growth curve analysis:

    • Record growth curves at various fluoride concentrations for both wild-type and knockout strains

    • Compare growth parameters (lag phase, growth rate, maximum OD)

  • Reporter gene assays:

    • Utilize fluoride riboswitches coupled to reporter genes to measure cellular response to fluoride

    • Reporter expression increases proportionally with fluoride concentration until toxicity occurs

  • Plate-based assays:

    • Test colony formation on solid media containing fluoride (e.g., Bulk plates with 1,000 mg/L fluoride)

For comprehensive characterization, researchers should employ multiple methods and include appropriate statistical analyses to quantify differences between strains.

What expression systems are most suitable for producing recombinant CrcB protein for biochemical studies?

Although the search results don't specifically address recombinant CrcB expression, the following recommendations are based on standard approaches for membrane protein expression:

  • Expression host selection:

    • E. coli strains specialized for membrane protein expression (C41(DE3), C43(DE3))

    • Alternative hosts such as Pichia pastoris for proteins that may be toxic to E. coli

  • Vector design considerations:

    • Inclusion of affinity tags (His, FLAG, etc.) for purification

    • Inducible promoters to control expression levels

    • Signal sequences for proper membrane targeting

  • Expression conditions optimization:

    • Lower induction temperatures (16-25°C) to reduce inclusion body formation

    • Screening different media compositions and induction parameters

    • Addition of specific lipids or osmolytes to stabilize membrane proteins

  • Solubilization and purification strategy:

    • Detergent screening for efficient solubilization from membranes

    • Affinity chromatography followed by size exclusion chromatography

    • Reconstitution into liposomes or nanodiscs for functional studies

Given CrcB's role as a fluoride transporter, functionality of the recombinant protein should be verified using fluoride transport assays.

How does CrcB achieve selectivity for fluoride over other anions?

The fluoride riboswitches that regulate crcB expression show remarkable selectivity, "selectively triggered by fluoride but reject other small anions, including chloride" . This suggests that CrcB protein may share similar selectivity mechanisms, though specific structural features enabling this selectivity remain to be fully characterized.

Research approaches to investigate this selectivity might include:

  • Structural studies: Determination of CrcB's three-dimensional structure to identify potential fluoride binding sites

  • Mutagenesis experiments: Systematic alteration of putative ion binding residues to identify those critical for fluoride selectivity

  • Electrophysiological studies: Patch-clamp or other electrophysiological approaches to measure ion conductance and selectivity

  • Computational modeling: Molecular dynamics simulations to model fluoride interactions with the protein

Understanding the structural basis for fluoride selectivity would provide valuable insights into ion transport mechanisms and potentially inform the design of biomimetic fluoride-selective membranes or sensors.

What is the phylogenetic distribution of CrcB across bacterial species and what does this reveal about its evolutionary history?

CrcB homologs are broadly distributed across bacterial and archaeal species, suggesting this fluoride resistance mechanism is evolutionarily ancient and widely conserved . Interestingly, CrcB proteins "vary greatly in amino acid sequence," yet are hypothesized to share the same function in fluoride toxicity resistance .

This pattern suggests functional conservation despite sequence divergence, which may indicate:

  • Evolutionary pressure: Widespread exposure to environmental fluoride has driven the conservation of fluoride resistance mechanisms across diverse lineages

  • Functional constraints: Despite sequence variation, specific structural elements must be preserved to maintain fluoride transport function

  • Convergent evolution: In some cases, functionally equivalent proteins may have evolved independently, as suggested by the observation that Streptococcus mutans encodes EriC F proteins in the same genomic location where other Streptococcus species encode CrcB proteins

The widespread distribution of CrcB across prokaryotes, and potentially in some eukaryotic lineages like fungi and plants , underscores the evolutionary importance of fluoride resistance mechanisms.

What is the relationship between CrcB and other fluoride resistance proteins like EriC F?

Multiple protein families appear to be involved in fluoride resistance, and evidence suggests some functional equivalence between them:

  • CrcB family: Predicted to function as fluoride transporters, widely distributed across bacteria and archaea

  • EriC F proteins:

    • The F CrcB gene of Escherichia coli and the eriC F gene of Pseudomonas syringae function as fluoride transporters

    • Streptococcus mutans encodes EriC F proteins in the genomic position where other Streptococcus species encode CrcB proteins, suggesting functional equivalence

  • CLC F proteins: Shown to function as fluoride channels, exporting fluoride to protect E. coli against toxicity

This apparent functional redundancy across different protein families highlights the biological importance of fluoride resistance. The distribution of these different proteins may reflect adaptation to specific ecological niches or taxonomic lineages.

How can researchers interpret gene expression data to understand the regulatory network controlling CrcB expression?

Analysis of gene expression data from E. cloacae FRM reveals important insights into CrcB regulation:

  • Differential expression analysis:

    • Exposure to fluoride increases expression of gpmA, crcB, and orf5249 approximately 10-fold

    • This upregulation was confirmed by both RNA-seq and qRT-PCR methodologies

  • Co-expression patterns:

    • RT-PCR using specific primers confirmed that gpmA, crcB, and orf5249 are co-transcribed as a single operon

    • This co-expression pattern helps identify genes that may be functionally related to fluoride resistance

  • Integration with phenotypic data:

    • Reporter gene expression driven by fluoride riboswitches increases proportionally with fluoride concentration until toxicity occurs

    • This correlation allows researchers to connect gene expression changes with physiological responses

When interpreting such data, researchers should consider:

  • The potential for indirect regulatory effects

  • The temporal dynamics of gene expression changes

  • The dose-response relationship between fluoride exposure and gene expression

  • The integration of transcriptomic data with other omics approaches (proteomics, metabolomics)

What statistical approaches are appropriate for analyzing fluoride resistance phenotypes in knockout studies?

For robust analysis of fluoride resistance phenotypes, the following statistical approaches are recommended:

Appropriate controls, biological replicates, and technical replicates are essential for robust statistical analysis of phenotypic data.

How might understanding CrcB function inform biotechnological applications for fluoride-contaminated environments?

Understanding CrcB's role in fluoride resistance could enable several biotechnological applications:

  • Bioremediation strategies:

    • Engineered bacteria overexpressing CrcB could potentially be used to remove fluoride from contaminated water sources

    • The high fluoride resistance of E. cloacae FRM (growing at fluoride concentrations up to 1,000 mg/L) suggests potential utility in high-fluoride environments

  • Biosensor development:

    • Fluoride riboswitches that regulate CrcB expression could be coupled to reporter genes to create sensitive and specific fluoride biosensors

    • Such biosensors could be used for environmental monitoring of fluoride levels

  • Synthetic biology applications:

    • CrcB and its regulatory elements could be incorporated into synthetic circuits designed to respond to or detoxify fluoride

    • Engineered microorganisms with enhanced fluoride resistance might be useful in industrial processes where fluoride is present

These applications require thorough understanding of CrcB function, regulation, and the broader cellular response to fluoride stress.

What relevance does CrcB have for understanding Enterobacter infections and potential antimicrobial strategies?

Enterobacter species, including E. cloacae, are important opportunistic pathogens associated with hospital-acquired infections . Understanding CrcB function could have implications for these infections:

  • Colonization mechanisms:

    • Fluoride resistance may contribute to bacterial survival in certain host environments or in the presence of fluoride-containing treatments

    • While not directly addressed in the search results, resistance mechanisms generally can contribute to bacterial persistence

  • Potential antimicrobial strategies:

    • Targeting CrcB or other fluoride resistance mechanisms could potentially sensitize bacteria to fluoride-based treatments

    • The fluoride riboswitches that regulate CrcB expression represent potential targets for antimicrobial development

  • Infection models:

    • Mouse models for studying Enterobacter colonization have been developed and could potentially be used to study the role of fluoride resistance in vivo

    • Such models could help assess whether targeting fluoride resistance mechanisms affects colonization or virulence

The widespread distribution of CrcB and other fluoride resistance mechanisms across bacterial species, including pathogens like Streptococcus mutans , suggests that these systems may play important roles in bacterial adaptation to host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.