Recombinant Enterobacter sp. Rhomboid protease glpG (glpG)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery details, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance. Additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
glpG; Ent638_3833; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
glpG
Target Protein Sequence
MLMITSFTNPRVAQAFVDYMATQGVVLTLQQHTQTDVWLADESQAERVNAELARFLENPG
DPRYLAASWTNGHMDSGLHYQRFPFFATVRERAGPFTLLLMAACILVFIIMNVVGDQRVM
IALAWPYGPAVQYDVWRYFTHALMHFSVLHILFNLLWWWYLGGAVEKRLGSGKLIVITII
SALLSGYVQHKFSGPWFGGLSGVVYALMGYAWLRGERDPESGIYMQRGLITFALLWLIAG
WFDLFGMSIANGAHVTGLAVGLAMAFADTLNARKRT
Uniprot No.
Target Background
Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
KEGG: ent:Ent638_3833
STRING: 399742.Ent638_3833
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
