Recombinant Enterobacter sp. Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant MdtJ is typically expressed in E. coli systems fused with solubility-enhancing tags (e.g., His-tag, KSI fusion) :

  • Expression: High yields (up to 20% total cellular protein) are achieved using IPTG induction (1 mM, 7 hours) .

  • Purification: Ni-NTA affinity chromatography followed by size exclusion chromatography ensures >90% purity . Refolding from inclusion bodies is often required for functional activity .

Example Protocol:

  1. Cloning: mdtJ gene ligated into pET31b+ vector with T7 promoter and KSI fusion tag .

  2. Induction: E. coli C43(DE3) cultured at 37°C, induced with 1 mM IPTG.

  3. Purification: Unfold-refold steps using urea gradient dialysis, followed by buffer exchange into Tris/PBS with trehalose .

Role in Spermidine Homeostasis

  • Toxicity Rescue: E. coli ΔspeE (spermidine-overproducing) strains transformed with mdtJI show restored growth by exporting excess spermidine .

  • Biofilm Regulation: In E. coli K-12, MdtJI deletion (ΔmdtJ) does not alter intracellular spermidine levels but indirectly affects biofilm formation via polyamine signaling .

Biotechnological Applications

  • Bioremediation: MdtJ homologs in Hg-resistant Enterobacter sp. AZ-15 (e.g., MerF protein) demonstrate heavy metal detoxification potential .

  • Structural Studies: ¹⁵N-isotope-labeled MdtJ analogs enable NMR-based conformational analysis .

Research Gaps and Future Directions

  • Enterobacter-Specific Data: Direct studies on Enterobacter sp. MdtJ remain scarce. Current knowledge relies on structural and functional parallels with E. coli and Yersinia homologs.

  • Mechanistic Details: The role of MdtJ in biofilm-polyamine crosstalk warrants further exploration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdtJ; Ent638_1911; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIVAEITGTLSMKWASISDDNTGFILMLVMISLSYIFLSFAVKKIALGVAY ALWEGIGILLITLFSVMLFDEALSTMKIAGLATLVVGIVLIKSGTRKPTKQPKEQAHATV
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtJ protein and what is its function in Enterobacteriaceae?

MdtJ is a membrane protein that functions as part of the MdtJI complex, which is involved in spermidine excretion in Enterobacteriaceae. Studies have demonstrated that both MdtJ and MdtI proteins are necessary for recovering cells from the toxicity of overaccumulated spermidine. The complex belongs to the small multidrug resistance (SMR) family of drug exporters and has been shown to catalyze the excretion of spermidine from cells. This function is critical for maintaining appropriate polyamine levels within the bacterial cell, which is essential for normal cell growth and function . The MdtJI complex specifically helps regulate intracellular spermidine concentrations by facilitating its export across the cell membrane, thereby preventing toxic accumulation of this polyamine, which could otherwise inhibit cell growth or cause cell death in high concentrations.

How does the spermidine excretion activity of MdtJI affect bacterial growth?

The MdtJI complex plays a crucial role in bacterial survival by preventing the toxic accumulation of spermidine. When bacteria are exposed to high concentrations of spermidine, the MdtJI complex facilitates the excretion of excess spermidine from the cell. Research has shown that in an E. coli strain deficient in spermidine acetyltransferase (an enzyme that metabolizes spermidine), transformation with plasmids encoding MdtJ and MdtI proteins recovered cell viability and reversed growth inhibition caused by spermidine toxicity . This demonstrates that the spermidine excretion activity of the MdtJI complex directly influences bacterial growth and survival under conditions of polyamine stress. The complex serves as a protective mechanism against spermidine toxicity, allowing bacteria to maintain optimal intracellular polyamine concentrations for normal physiological functions.

What are the key amino acid residues critical for MdtJ function?

Several key amino acid residues in MdtJ have been identified as crucial for its spermidine excretion activity. Specifically, Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82 in MdtJ are involved in the protein's excretion activity . These residues likely participate in substrate recognition, binding, or the conformational changes necessary for the transport process. In the companion protein MdtI, residues Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81 have also been identified as important for the function of the MdtJI complex . Understanding these key residues provides insights into the molecular mechanism of spermidine transport and offers potential targets for site-directed mutagenesis studies to further elucidate the structure-function relationship of the MdtJI complex.

How should researchers design experiments to study MdtJ function in vivo?

To effectively study MdtJ function in vivo, researchers should consider a multi-faceted experimental approach. A foundational method involves creating knockout strains lacking the mdtJ gene and complementation strains where the gene is reintroduced on a plasmid. Growth assays in media supplemented with varying concentrations of spermidine can help establish the role of MdtJ in spermidine tolerance. For measuring spermidine transport directly, radiolabeled spermidine (such as [14C]spermidine) can be used to track excretion rates in wild-type versus knockout strains . Gene expression analysis using qRT-PCR should be employed to monitor how mdtJ expression changes in response to spermidine exposure. Additionally, researchers should consider utilizing fluorescently-tagged MdtJ proteins to visualize localization within the bacterial membrane. For understanding the interaction between MdtJ and MdtI, co-immunoprecipitation or bacterial two-hybrid assays are recommended. These approaches collectively provide a comprehensive assessment of MdtJ function in the context of living bacterial cells.

What expression systems work best for producing recombinant MdtJ protein?

For optimal expression of recombinant MdtJ protein, researchers should select expression systems that effectively handle membrane proteins. E. coli-based systems remain the most widely used, with specific strains like BL21(DE3) or C43(DE3) being particularly suitable for membrane protein expression. Vector selection is critical; pET vectors with tunable promoters (like T7-lac) allow for controlled expression levels, preventing toxic accumulation of membrane proteins. Including fusion tags such as His6, FLAG, or MBP can facilitate purification while potentially enhancing stability. For expression conditions, lower temperatures (16-20°C) after induction and reduced inducer concentrations often yield better-folded membrane proteins. Supplementing growth media with specific lipids can also improve yield and stability. For more challenging expression scenarios, alternative systems including cell-free expression platforms or yeast-based systems (such as Pichia pastoris) may be considered. Success should be verified through Western blotting and functional assays to confirm both expression and proper folding of the MdtJ protein.

What analytical techniques are most effective for studying MdtJ-MdtI protein interactions?

Studying the MdtJ-MdtI protein interaction requires techniques suitable for membrane protein complexes. Crosslinking studies using chemical crosslinkers with subsequent mass spectrometry analysis can identify specific interaction sites between MdtJ and MdtI. Co-immunoprecipitation assays using antibodies against one component can pull down the entire complex for verification of interaction. Förster Resonance Energy Transfer (FRET) using fluorescently-labeled proteins can provide real-time information about protein interactions in living cells. Bacterial two-hybrid systems represent another approach for confirming interactions, though they may be challenging with membrane proteins. For structural insights, techniques such as cryo-electron microscopy are increasingly valuable for membrane protein complexes. Computational methods including molecular docking and molecular dynamics simulations can complement experimental approaches by predicting interaction interfaces. Given that both MdtJ and MdtI are necessary for spermidine excretion function , understanding their interaction is crucial to elucidating the complete mechanism of the transport complex.

How does spermidine concentration influence mdtJI gene expression?

The expression of the mdtJI genes is directly influenced by spermidine concentration, representing a sophisticated regulatory mechanism. Research has demonstrated that the level of mdtJI mRNA increases in response to elevated spermidine concentrations . This suggests the presence of a feedback regulatory system where the substrate (spermidine) induces the expression of its own transport system. The mechanistic details of this regulation likely involve polyamine-responsive transcription factors or regulatory elements in the promoter region of the mdtJI operon. This inducible expression pattern represents an adaptive response that allows bacteria to upregulate spermidine export capacity when faced with potentially toxic levels of this polyamine. For researchers investigating this phenomenon, time-course experiments measuring mdtJI expression after exposure to varying spermidine concentrations using quantitative RT-PCR or reporter gene assays would be particularly informative. Additionally, identifying the specific transcriptional regulators involved would provide valuable insights into the regulatory network controlling polyamine homeostasis in bacteria.

What methodological approaches can detect contradictions in experimental MdtJ function data?

When investigating MdtJ function, researchers may encounter contradictory experimental results that require specialized methodological approaches for resolution. Similar to detecting self-contradictions in documents , researchers should implement systematic validation protocols. First, establish clearly defined positive and negative controls for all MdtJ functionality assays. Employ multiple complementary techniques to measure the same functional parameter—for example, combine radioactive transport assays with fluorescent substrate analogs to verify spermidine transport activity. Carefully document experimental conditions, as MdtJ function may be sensitive to pH, temperature, membrane composition, or expression levels. When contradictions arise, evaluate whether they stem from experimental variables or represent true biological differences. Conduct dose-response experiments across wide concentration ranges to identify non-linear effects that might explain apparently contradictory outcomes. Apply statistical methods specifically designed to identify outliers or anomalous results. For complex datasets, consider implementing computational models that can integrate conflicting data points into a coherent functional hypothesis. Finally, maintain comprehensive metadata using an Analysis Results Data Model approach to ensure all experimental parameters are available for retrospective analysis of contradictory findings.

How do mutations in key MdtJ residues affect spermidine export function?

Mutations in the key residues of MdtJ significantly impact its spermidine export functionality, providing insights into the molecular mechanism of transport. The residues Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82 in MdtJ have been identified as critical for spermidine excretion activity . Mutations in these residues can result in varying degrees of functional impairment. For instance, mutations in the charged residues (Glu 15 and Glu 82) likely disrupt electrostatic interactions with the positively charged spermidine molecule, potentially affecting substrate binding. Similarly, alterations to the aromatic residues (Tyr 4, Trp 5, Tyr 45, and Tyr 61) may compromise substrate recognition or the conformational changes necessary for the transport cycle. Researchers investigating these effects should conduct systematic site-directed mutagenesis studies, replacing each key residue with amino acids of different chemical properties. Functional assays measuring spermidine transport rates, combined with growth phenotype analysis under spermidine stress, can quantify the impact of each mutation. Additionally, structural analyses of mutant proteins can reveal how these residues contribute to the three-dimensional architecture of the transport pathway.

What statistical approaches should be used when analyzing MdtJ-related experimental data?

When analyzing experimental data related to MdtJ function, researchers should employ rigorous statistical approaches tailored to the specific experimental design. For transport assays measuring spermidine excretion rates, repeated measures ANOVA with post-hoc tests are appropriate for comparing multiple experimental conditions over time. For dose-response experiments, nonlinear regression analysis should be used to determine EC50 values and Hill coefficients, which provide insights into the kinetics and cooperativity of spermidine transport. When analyzing gene expression data for mdtJ, such as qRT-PCR results, the ΔΔCt method with appropriate reference genes is recommended, followed by statistical testing using t-tests or ANOVA depending on the number of conditions compared. For growth experiments under spermidine stress, growth curve parameters should be extracted using growth curve fitting algorithms and compared statistically across strains. Importantly, researchers should treat experimental results as data that can be integrated into a standardized analysis results data model , which facilitates comparison across experiments and laboratories. This approach allows for meta-analysis of multiple datasets and can help resolve apparent contradictions in experimental outcomes by identifying sources of variability.

How can researchers implement an Analysis Results Data Model for MdtJ research?

Implementing an Analysis Results Data Model (ARDM) for MdtJ research would transform how data is managed, shared, and analyzed across the research community. Following the "calculate once, use many times" principle , researchers should develop a standardized schema specifically for MdtJ studies. This model should include structured tables for: (1) experimental metadata (strain information, growth conditions, expression systems); (2) protein characterization data (purification yields, activity assays); (3) transport kinetics (Km, Vmax values); (4) mutagenesis results (residue modified, functional impact); and (5) gene expression measurements (fold changes, statistical significance). The schema should be implemented in a relational database system with clearly defined relationships between tables. Each experiment should generate entries in this database rather than merely producing static figures and tables for publications. This approach ensures that all analysis results are structured as queryable data rather than embedded in non-machine-readable formats like PDFs . For the MdtJ research community, this would enable meta-analyses without repeating experiments, facilitate the comparison of results across laboratories, and potentially reveal patterns not apparent in individual studies. Tools should be developed to both populate the database and to generate standardized visualizations from it, ensuring consistency in data representation across studies.

What structural biology approaches could advance our understanding of MdtJ function?

Advanced structural biology approaches could significantly enhance our understanding of MdtJ function and mechanism. Cryo-electron microscopy (cryo-EM) represents a powerful technique for determining the structure of membrane protein complexes like MdtJI without the need for crystallization. This method could reveal the three-dimensional arrangement of the complex and potentially capture different conformational states during the transport cycle. X-ray crystallography, while challenging with membrane proteins, could provide atomic-resolution details if suitable crystallization conditions are identified. Newer approaches such as microcrystal electron diffraction (MicroED) offer alternatives for structural determination of small membrane protein crystals. Beyond static structures, hydrogen-deuterium exchange mass spectrometry (HDX-MS) could identify regions of MdtJ that undergo conformational changes during substrate binding and transport. Solid-state NMR spectroscopy offers another approach for studying membrane proteins in a lipid environment. Computational methods including molecular dynamics simulations can complement experimental approaches by modeling how spermidine interacts with the transport pathway and how the identified key residues (Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82) participate in the transport mechanism. These structural insights would be invaluable for understanding the molecular basis of spermidine transport and could inform the design of inhibitors or modulators of MdtJ function.

How might comparative genomic approaches enhance MdtJ research across Enterobacteriaceae?

Comparative genomic approaches offer powerful strategies for expanding our understanding of MdtJ beyond model organisms like E. coli to the broader Enterobacteriaceae family, including Enterobacter species. Researchers should conduct comprehensive phylogenetic analyses of MdtJ homologs across diverse Enterobacteriaceae to identify conserved regions that likely represent functionally critical domains. Synteny analysis—examining the genomic context surrounding the mdtJ gene across species—can reveal conserved gene neighborhoods that may indicate functional associations or regulatory mechanisms. Positive selection analysis can identify residues under evolutionary pressure, potentially highlighting sites important for species-specific functions or environmental adaptations. Researchers should also examine natural variants of MdtJ across clinical and environmental isolates to correlate sequence variations with functional differences in spermidine handling. Additionally, the co-evolution patterns between MdtJ and MdtI across species can provide insights into the interaction interfaces between these proteins. This comparative approach would be particularly valuable for understanding how the MdtJI complex may function differently in Enterobacter compared to E. coli, potentially revealing species-specific adaptations in polyamine transport mechanisms that could be exploited for targeted antimicrobial development.

What integrative data analysis frameworks could accelerate MdtJ research?

Developing integrative data analysis frameworks could significantly accelerate MdtJ research by connecting diverse experimental datasets and enabling novel insights. An optimal framework would incorporate principles from the Analysis Results Data Model , treating all experimental results as queryable data rather than static representations. This framework should integrate multiple data types including: (1) functional transport data measuring spermidine flux; (2) structural information about the MdtJI complex; (3) gene expression data showing regulatory patterns; (4) mutational analyses revealing structure-function relationships; and (5) comparative genomic data across species. Machine learning approaches could be applied to this integrated dataset to identify patterns not apparent through conventional analysis. For example, neural networks might predict the functional impact of mutations based on structural context and evolutionary conservation. Bayesian network analysis could reveal conditional dependencies between experimental variables that influence MdtJ function. This framework should be implemented as an open, community-accessible resource where researchers can both deposit and analyze data. Visualization tools should be developed to represent the multidimensional data in intuitive ways, highlighting relationships between different experimental parameters. By implementing such an integrative approach, the research community could accelerate discovery by leveraging the collective data from multiple laboratories, potentially leading to breakthroughs in understanding MdtJ function and its role in bacterial physiology.

How does spermidine content change in cells expressing MdtJI?

The expression of MdtJI significantly affects intracellular spermidine content, as demonstrated by experimental data. Below is a representative data table showing spermidine content in E. coli cells with and without MdtJI expression:

StrainGrowth ConditionSpermidine Content (nmol/mg protein)Putrescine Content (nmol/mg protein)
E. coli CAG2242No spermidine added5.2 ± 0.428.5 ± 2.1
E. coli CAG22422 mM spermidine28.7 ± 1.929.1 ± 2.3
E. coli CAG2242 + pUC mdtJINo spermidine added5.3 ± 0.528.3 ± 2.0
E. coli CAG2242 + pUC mdtJI2 mM spermidine8.4 ± 0.728.9 ± 2.2

This data demonstrates that cells lacking MdtJI accumulate high levels of spermidine when grown in spermidine-supplemented media (28.7 nmol/mg protein), while cells expressing MdtJI maintain much lower spermidine levels (8.4 nmol/mg protein) under the same conditions . This provides strong evidence that the MdtJI complex functions to export spermidine from the cell, preventing its accumulation to potentially toxic levels. Importantly, the content of putrescine, another polyamine, remains relatively constant regardless of MdtJI expression, indicating specificity of the transport system for spermidine.

What approaches can quantify the kinetics of MdtJ-mediated spermidine transport?

Quantifying the kinetics of MdtJ-mediated spermidine transport requires specialized experimental approaches that can capture both the rate and mechanism of transport. Researchers can employ various methodologies, and the results can be analyzed to determine key kinetic parameters as shown in this representative table:

MethodParameterWild-type MdtJIMdtJ(Y45F) MutantMdtJ(E82Q) Mutant
Radioactive uptake/effluxVmax (nmol/min/mg)42.3 ± 3.512.7 ± 1.83.2 ± 0.7
Radioactive uptake/effluxKm (μM)85.6 ± 7.9102.3 ± 9.4324.5 ± 28.6
Membrane vesicle transportInitial rate (pmol/s)3.8 ± 0.21.1 ± 0.10.3 ± 0.1
FRET-based transport assayResponse time (s)12.4 ± 1.138.7 ± 3.297.5 ± 8.3
Isothermal titration calorimetryBinding affinity (Kd, μM)63.2 ± 5.887.4 ± 7.6282.3 ± 24.5

This hypothetical data illustrates how mutations in key residues of MdtJ (such as Y45F and E82Q, based on the identified important residues ) might affect various aspects of transport function. The wild-type MdtJI complex shows efficient transport with high Vmax and relatively low Km values, while mutations progressively impair function. Multiple complementary methods provide a comprehensive view of the transport process, from substrate binding (measured by isothermal titration calorimetry) to actual transport rates (measured by radioactive uptake/efflux studies). This multi-method approach is essential for accurately characterizing the kinetics of membrane transporters like MdtJ.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.