Recombinant Enterobacter sp. Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate any special requirements you may have. Please indicate your desired format in the order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life can be influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
msrQ; Ent638_3691; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
msrQ
Target Protein Sequence
MRLTAKQITWLKVILHLAGLLPFIWLFWAASQGYFSADPAKDIQHFTGRMALKFLLASLL ISPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGINNLALLGSELISRPYLTL GIVSWVILFALTLTSTQYAQRKLGRRWQFLHNFVYLVAILTPIHYLWSVKILSPQPVIYA LLALGLLAWRYKKFRQWWR
Uniprot No.

Target Background

Function
YedZ is a component of the MsrPQ system, which is responsible for repairing oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O). This repair process utilizes respiratory chain electrons. MsrPQ safeguards these proteins from oxidative-stress damage caused by reactive oxygen and chlorine species generated by the host defense mechanisms. It is essential for maintaining envelope integrity under bleach stress, rescuing a wide array of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ transfers electrons to the reductase catalytic subunit MsrP, using the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the YedZ protein family and where is it found?

YedZ is an integral membrane protein with 6 transmembrane spanning (TMS) segments. This protein family has been identified in both bacteria and animals, but notably absent in Archaea and other eukaryotic kingdoms . In bacterial systems, YedZ homologues are particularly well-characterized in Escherichia coli, where they serve as prototype models for the family. Within Enterobacteriaceae, YedZ proteins share conserved structural features while demonstrating species-specific variations that may correlate with functional adaptations . The conservation pattern of YedZ across diverse bacterial species but limited to specific evolutionary lineages suggests it plays specialized roles that became advantageous in certain biological contexts rather than being essential for all cellular life.

What are the structural characteristics of YedZ proteins?

YedZ proteins feature a distinctive structure consisting of 6 transmembrane spanning segments with conserved histidyl residues strategically positioned within these transmembrane domains . These histidine residues are believed to serve as critical coordination sites for heme binding, which is essential for the protein's electron transfer function. Evolutionary analysis reveals that YedZ proteins have arisen through intragenic triplication of a 2 TMS-encoding genetic element, explaining their characteristic hexahelical membrane topology . This structural arrangement creates three pairs of transmembrane helices, each potentially capable of participating in heme coordination or protein-protein interactions necessary for electron transport chains.

What is the proposed function of YedZ proteins?

Based on structural and comparative analyses, YedZ homologues are proposed to function as heme-binding proteins that facilitate or regulate oxidoreduction processes, transmembrane electron flow, and transport functions . Their conserved histidyl residues in transmembrane domains are thought to coordinate heme molecules, which would enable them to participate in electron transfer reactions. This functional role is further supported by the observation that YedZ exhibits sequence similarity to putative heme export systems and cytochrome-containing electron carriers . In Enterobacter species, the YedZ subunit likely contributes to sulfoxide reductase activity by mediating electron transfer between membrane-associated components of redox systems.

How can recombinant YedZ protein be expressed and purified?

Recombinant expression of YedZ typically involves cloning the coding sequence into an appropriate expression vector with a fusion tag to facilitate purification. For membrane proteins like YedZ, expression systems must be carefully selected to ensure proper protein folding and membrane insertion. E. coli-based expression systems are commonly used, with strains specifically engineered for membrane protein expression. Purification generally follows a protocol involving:

  • Cell lysis and membrane fraction isolation through differential centrifugation

  • Solubilization of membrane proteins using detergents like n-dodecyl-β-D-maltoside (DDM)

  • Affinity chromatography using the fusion tag (often His-tag)

  • Size exclusion chromatography for further purification

For Enterobacter sp. YedZ specifically, codon optimization based on the host expression system may improve yields. During purification, it's critical to maintain conditions that preserve native folding and heme association, including appropriate buffer systems with stabilizing agents .

How can transposon mutagenesis be utilized to study YedZ function in Enterobacter species?

Transposon mutagenesis represents a powerful approach for investigating YedZ function through targeted disruption of the yedZ gene. The technique employs a Tn5-derived transposome system consisting of a linear DNA segment containing an R6K γ replication origin, a kanamycin resistance marker, and mosaic sequence ends serving as transposase binding sites . For Enterobacter sp. studies, the following methodological approach is recommended:

  • Introduce the transposome complex into prototrophic Enterobacter sp. via electroporation

  • Select transformants on Luria-Bertani agar containing kanamycin (LB-kan)

  • Replica plate onto minimal medium (M-9) with kanamycin to identify mutants with altered growth phenotypes

  • Extract genomic DNA from potential yedZ mutants for downstream analysis

  • Perform partial digestion of genomic DNA, followed by ligation and transformation into a pir+ E. coli strain

  • Recover and sequence plasmids containing the transposon and flanking genomic regions to confirm yedZ disruption

This approach enables precise identification of the interrupted gene and subsequent phenotypic characterization. For yedZ specifically, researchers should examine changes in electron transport capacity, heme binding efficiency, and sulfoxide reductase activity in the mutant strains compared to wild-type controls .

What methods can be used to assess heme binding in recombinant YedZ proteins?

Evaluating heme binding in recombinant YedZ requires specialized spectroscopic and biochemical techniques that can confirm both the presence and coordination state of heme molecules. A comprehensive methodological approach should include:

  • UV-Visible Spectroscopy: Analysis of characteristic Soret and Q-bands (typically around 410-420 nm and 500-600 nm, respectively) to confirm heme association and examine changes upon reduction/oxidation

  • Resonance Raman Spectroscopy: To determine the coordination state of the heme iron and identify specific amino acid ligands

  • Electron Paramagnetic Resonance (EPR): For detailed analysis of the electronic structure of the heme iron

  • Circular Dichroism (CD): To examine secondary structure elements and conformational changes associated with heme binding

  • Isothermal Titration Calorimetry (ITC): To determine binding constants and thermodynamic parameters of heme association

YedZ proteins contain conserved histidyl residues in their transmembrane domains that likely function in heme binding . Therefore, site-directed mutagenesis of these residues, followed by spectroscopic analysis, can provide definitive evidence regarding their role in heme coordination. Additionally, comparing wild-type and mutant proteins using the techniques above would reveal the specific contributions of these histidine residues to the structural and functional integrity of YedZ.

How do YedZ proteins interact with other components of electron transport systems?

YedZ proteins likely function within broader electron transport networks through specific protein-protein interactions. To elucidate these interactions in Enterobacter species, researchers should employ the following approaches:

  • Pull-down assays: Using affinity-tagged recombinant YedZ to identify interacting partners

  • Bacterial two-hybrid systems: For screening potential interaction partners in vivo

  • Cross-linking coupled with mass spectrometry: To identify transient or weak interactions within the membrane environment

  • Co-immunoprecipitation: To verify interactions under native conditions

  • Förster Resonance Energy Transfer (FRET): To observe interactions in real-time in living cells

Evidence from related bacterial systems suggests YedZ may interact with components of sulfoxide reductase systems and other membrane-bound electron transport proteins . In magnetotactic bacteria and cyanobacteria, YedZ domains are found fused to transport and electron transfer proteins, indicating functional integration within these systems . Understanding these interaction networks is crucial for elucidating the complete electron transfer pathway involving YedZ in Enterobacter species.

What are the evolutionary relationships between bacterial and animal YedZ homologues?

Phylogenetic analysis of YedZ homologues reveals a complex evolutionary history spanning bacterial and animal kingdoms, with notable absences in Archaea and other eukaryotic lineages . To investigate these relationships:

  • Perform comprehensive sequence alignments of YedZ homologues from diverse species

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Analyze conservation patterns of key structural elements, particularly transmembrane histidine residues

  • Examine synteny and genomic context of yedZ genes across species

The observation that animal homologues have YedZ domains fused C-terminal to homologues of coenzyme F420-dependent NADP oxidoreductases suggests functional co-option during evolution . One particularly notable animal homologue is the 6 TMS epithelial plasma membrane antigen of the prostate (STAMP1) that is overexpressed in prostate cancer, indicating potential functional diversification in higher organisms . This evolutionary relationship offers opportunities to understand how electron transport mechanisms have been conserved and modified across diverse biological systems.

What expression systems are optimal for producing functional recombinant YedZ?

The expression of functional recombinant YedZ requires careful consideration of host systems due to its nature as an integral membrane protein with heme-binding properties. Recommended expression strategies include:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli C41(DE3)/C43(DE3)Specialized for membrane proteins; high yieldsMay form inclusion bodiesLower induction temperature (16-20°C); use mild inducers
Bacterial cell-free systemsAvoids toxicity issues; direct incorporation into nanodiscs/liposomesHigher cost; lower yieldSupplement with membrane mimetics and heme precursors
Yeast (P. pastoris)Post-translational modifications; natural membrane insertionLonger expression timeOptimize codon usage; use inducible promoters
Insect cell systemsComplex folding machinery; eukaryotic membranesHigher cost; more complex protocolsOptimize signal sequences; baculovirus optimization

For Enterobacter sp. YedZ specifically, E. coli-based systems generally provide the best balance of yield and functionality, particularly when the protein is expressed with a fusion partner such as maltose-binding protein (MBP) or thioredoxin to improve solubility . Co-expression with chaperone proteins can significantly enhance proper folding and membrane insertion. Additionally, supplementing growth media with δ-aminolevulinic acid (a heme precursor) often improves the incorporation of heme into the recombinant protein.

How can directed evolution approaches be applied to engineer YedZ variants with enhanced properties?

Directed evolution offers powerful strategies for engineering YedZ variants with enhanced stability, activity, or novel functions. A comprehensive methodology involves:

  • Library Generation:

    • Error-prone PCR with controlled mutation rates

    • DNA shuffling of yedZ genes from different bacterial species

    • Site-saturation mutagenesis targeting conserved histidyl residues

    • Domain swapping with related proteins from the electron transport chain

  • Selection System Design:

    • Develop a growth-based selection in minimal media linking YedZ function to cell survival

    • Create colorimetric or fluorescent assays to detect electron transfer activity

    • Establish high-throughput screening for heme binding using modified hemoglobin binding assays

  • Iterative Improvement:

    • Perform multiple rounds of selection with increasing stringency

    • Combine beneficial mutations through DNA shuffling

    • Verify improved variants through detailed biochemical characterization

This approach is particularly valuable for developing YedZ variants with enhanced stability in different detergents for structural studies or improved electron transfer rates for biotechnological applications. The transposon mutagenesis techniques described for Enterobacter sp. can be adapted to create initial libraries for directed evolution experiments .

What are the most effective approaches for studying YedZ structure-function relationships?

Investigating structure-function relationships in YedZ requires integrating multiple experimental approaches:

  • Computational Structure Prediction:

    • Homology modeling based on related membrane proteins

    • Molecular dynamics simulations to predict heme coordination and membrane interactions

    • Evolutionary coupling analysis to identify co-evolving residues that may be functionally linked

  • Site-Directed Mutagenesis:

    • Systematic mutation of conserved histidyl residues in transmembrane domains

    • Alanine scanning of potential protein-protein interaction interfaces

    • Introduction of spectroscopic probes at strategic positions

  • Functional Assays:

    • Electron transfer measurements using artificial electron acceptors

    • Reconstitution in proteoliposomes to measure transmembrane electron flow

    • Sulfoxide reductase activity assays in native and recombinant systems

  • Structural Biology Approaches:

    • X-ray crystallography of detergent-solubilized protein

    • Cryo-electron microscopy for membrane-embedded structures

    • Solid-state NMR to examine specific interactions in the membrane environment

By correlating structural features with functional outcomes, researchers can map the molecular determinants of YedZ activity. The observation that YedZ homologues have arisen by intragenic triplication of a 2 TMS-encoding element provides a foundation for understanding how the protein's architecture supports its electron transfer function .

How should researchers interpret contradictory data on YedZ function across different bacterial species?

When encountering contradictory data on YedZ function across different bacterial species, researchers should implement a systematic analytical framework:

  • Taxonomic Context Analysis:

    • Examine the evolutionary distance between the species being compared

    • Consider the genomic context of yedZ genes in each organism

    • Analyze co-occurring genes that might influence YedZ function

  • Methodological Differences Assessment:

    • Evaluate experimental conditions (pH, temperature, ionic strength) across studies

    • Compare protein purification methods and their impact on heme retention

    • Examine differences in activity assays and their sensitivity/specificity

  • Protein Sequence and Structure Comparison:

    • Align sequences to identify key variations in functional residues

    • Compare predicted transmembrane topologies

    • Analyze conservation of histidyl residues and other potential heme coordination sites

  • Integrated Data Modeling:

    • Develop testable hypotheses that explain the observed discrepancies

    • Design experiments specifically targeting the conflicting aspects

    • Consider species-specific partners that might modulate YedZ function

This approach recognizes that YedZ proteins, despite their conserved core features, may have evolved distinct functional specializations in different bacterial lineages. The observation that some YedZ homologues in magnetotactic bacteria and cyanobacteria are fused to transport and electron transfer proteins suggests functional diversity within this protein family .

What bioinformatic approaches can identify novel YedZ-related proteins in genomic data?

Identifying novel YedZ-related proteins in genomic data requires sophisticated bioinformatic strategies beyond standard BLAST searches:

  • Profile-Based Searches:

    • Construct position-specific scoring matrices (PSSMs) from aligned YedZ sequences

    • Use profile Hidden Markov Models (HMMs) to detect distant homologues

    • Implement PSI-BLAST with iterative refinement of search profiles

  • Structural Prediction Integration:

    • Employ transmembrane topology prediction tools to identify candidates with similar membrane architecture

    • Search for proteins with the characteristic 6 TMS pattern derived from intragenic triplication

    • Use fold recognition methods to identify proteins with similar structural features

  • Genomic Context Analysis:

    • Examine gene neighborhood conservation patterns

    • Identify operons containing genes involved in electron transport or heme metabolism

    • Look for fusion proteins containing YedZ-like domains, as seen in some bacterial species

  • Machine Learning Approaches:

    • Train neural networks on known YedZ features

    • Implement support vector machines for classification of potential homologues

    • Use deep learning to identify subtle patterns in sequence data

These approaches have already revealed YedZ homologues in bacteria and animals, while confirming their absence in Archaea and other eukaryotic kingdoms . The discovery of the prostate cancer-associated STAMP1 protein as a YedZ homologue demonstrates the value of sophisticated bioinformatic approaches in identifying functionally important protein relationships across diverse organisms.

How might understanding YedZ function inform antimicrobial development against Enterobacter infections?

The rising prevalence of multidrug-resistant Enterobacter species, particularly within the Enterobacter cloacae complex (ECC), necessitates novel antimicrobial strategies . YedZ's role in electron transport processes presents potential opportunities for therapeutic intervention:

  • YedZ as a Drug Target:

    • Develop small molecules that disrupt heme binding by targeting conserved histidyl residues

    • Design peptide inhibitors that interfere with YedZ protein-protein interactions

    • Create compounds that block electron transfer without affecting human homologues

  • Resistance Considerations:

    • Analyze conservation of YedZ across clinical isolates to assess target validity

    • Evaluate potential for resistance development through mutations in the yedZ gene

    • Consider combination approaches targeting multiple components of electron transport chains

  • Mechanistic Strategies:

    • Target YedZ-mediated electron transfer to compromise bacterial energy metabolism

    • Disrupt YedZ's potential role in detoxification processes

    • Exploit YedZ's membrane location for targeted delivery of antimicrobial compounds

The discovery of novel sequence types in clinical Enterobacter isolates and the spread of antimicrobial resistance genes like mcr-9 and blaNDM underscore the urgent need for new therapeutic approaches against these pathogens . YedZ's conservation across bacterial species but absence in humans could make it an attractive target for selective antimicrobial development.

What are the implications of YedZ homology to human proteins like STAMP1 for cancer research?

The identification of STAMP1 (Six Transmembrane Epithelial Antigen of Prostate 1) as a YedZ homologue in humans establishes a fascinating connection between bacterial electron transport and human disease, particularly prostate cancer . Research implications include:

  • Functional Parallels:

    • Investigate whether STAMP1 retains heme-binding capacity through histidine residues

    • Examine if STAMP1 participates in electron transfer processes in human cells

    • Explore whether STAMP1 overexpression in cancer cells alters cellular redox state

  • Structural Insights:

    • Use bacterial YedZ as a model system for understanding STAMP1 structure

    • Apply knowledge of YedZ transmembrane topology to design STAMP1-targeted compounds

    • Leverage the evolutionary relationship to identify critical functional motifs

  • Therapeutic Applications:

    • Develop inhibitors targeting conserved functional domains shared between YedZ and STAMP1

    • Explore the potential of STAMP1 as a biomarker for prostate cancer progression

    • Investigate whether disrupting STAMP1 function can selectively affect cancer cells

This evolutionary relationship between bacterial YedZ proteins and the cancer-associated STAMP1 protein exemplifies how fundamental research on bacterial proteins can yield unexpected insights into human disease . The observation that animal YedZ homologues have domains fused to coenzyme F420-dependent NADP oxidoreductases further suggests functional connections to redox regulation pathways that may be relevant in cancer metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.