Recombinant Enterobacter sp. Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Ent638_3460; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
uppP
Target Protein Sequence
MSDMHSLLVAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGETAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPPQHEGEGKGRLTLIHILLGMVPAVVLGLIFHDAIKSLFNPI NVMYALVVGGVLLIAAELLKPKEPKAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSYHFLTAADFPMFAVGFVTAFLVALV AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (UppP) and what role does it play in bacterial cell wall synthesis?

Undecaprenyl pyrophosphate phosphatase (UppP) is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate (Und-P), also known as bactoprenol phosphate. This reaction is critical for bacterial cell wall synthesis as Und-P serves as an essential carrier lipid upon which the bacterial cell wall components are assembled .

The importance of UppP stems from its role in the recycling pathway of the carrier lipid. After undecaprenyl-linked cell wall precursors are utilized for cell wall synthesis, the carrier must be dephosphorylated to be reused in subsequent rounds of cell wall assembly. This recycling is crucial because Und-P is found in finite amounts in bacterial cells such as Escherichia coli and Staphylococcus aureus .

How does the structure of UppP relate to its function?

The active site of UppP is composed of two conserved consensus regions that are critical for its phosphatase activity. Sequence alignment has revealed that these regions contain glutamate-rich (E/Q) motifs . Through a combination of computational modeling, molecular dynamics simulations, and site-directed mutagenesis studies, researchers have proposed that the active site of UppP is located in the periplasmic region of the protein.

Specifically, the active site appears to contain the motifs (E/Q)XXXE and PGXSRSXXT, along with a conserved histidine residue. These structural elements are believed to coordinate with magnesium ions and the substrate to facilitate the dephosphorylation reaction . This structural arrangement enables UppP to effectively bind the undecaprenyl pyrophosphate substrate and catalyze its conversion to undecaprenyl phosphate.

How does Enterobacter sp. UppP compare to orthologous enzymes in other bacterial species?

While the search results don't provide specific information about Enterobacter sp. UppP, we can draw comparisons based on UppP from related gram-negative bacteria. UppP is highly conserved across bacterial species, with similar functional roles observed in E. coli, Bacillus subtilis, S. aureus, and Enterococcus faecalis .

What are the recommended protocols for expression and purification of recombinant Enterobacter sp. UppP?

Based on protocols used for UppP from other bacterial species, the following approach can be adapted for Enterobacter sp. UppP:

  • Cloning and Expression System: The uppP gene can be amplified from Enterobacter sp. genomic DNA and cloned into an appropriate expression vector containing a histidine tag for purification purposes. E. coli BL21(DE3) or similar strains are commonly used as expression hosts.

  • Induction Conditions: Since UppP is a membrane protein, expression should be carefully optimized. Using lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) can help increase the yield of properly folded protein .

  • Membrane Protein Extraction: Due to its membrane-associated nature, UppP requires detergent solubilization. Common detergents include n-dodecyl-β-D-maltoside (DDM) at 0.02% concentration, which has been successfully used for UppP from other species .

  • Purification Process: Purification typically involves immobilized metal affinity chromatography (IMAC) using the histidine tag, followed by size exclusion chromatography to enhance purity.

The quality of the purified enzyme can be assessed using SDS-PAGE, Western blotting, and activity assays to ensure both purity and functionality.

How can the enzymatic activity of UppP be measured accurately?

The enzymatic activity of UppP can be measured using several complementary approaches:

  • Malachite Green Phosphate Assay: This is a widely used method to detect phosphate release during the dephosphorylation reaction. The standard reaction mixture typically contains buffer (50 mM Hepes, pH 7.0), salt (150 mM NaCl), cation (10 mM MgCl2), detergent (0.02% DDM), substrate (farnesyl pyrophosphate, Fpp, as an analog of undecaprenyl pyrophosphate), and purified UppP. After incubation at 37°C, the reaction is quenched by adding Malachite Green reagent, and the released phosphate is measured spectrophotometrically at 650 nm .

  • pH Dependence Studies: The effect of pH on UppP activity can be assessed using different buffers covering a range of pH values, such as sodium acetate (pH 5-6), Hepes (pH 6.5-8), and Tris-HCl (pH 9) .

  • Kinetic Parameter Determination: For determining Km and kcat values, varying concentrations of substrate (typically 0.3-57 μM Fpp) are used with 20-40 nM UppP. The initial velocity data can be fitted to the Michaelis-Menten equation to obtain these kinetic parameters .

The table below summarizes typical reaction conditions for UppP activity assays:

ParameterTypical Condition
Buffer50 mM Hepes, pH 7.0
Salt150 mM NaCl
Divalent Cation10 mM MgCl₂
Detergent0.02% DDM
Substrate0.3-57 μM Fpp
Enzyme Concentration20-40 nM
Temperature37°C
Detection MethodMalachite Green assay (650 nm)

What structural analysis techniques are most effective for studying UppP?

Several structural analysis techniques have proven effective for studying UppP and related membrane proteins:

  • X-ray Crystallography: Although challenging for membrane proteins, crystallography provides the highest resolution structural information. Success often depends on finding appropriate detergents or lipid cubic phase systems for crystallization.

  • Molecular Modeling and Dynamics Simulations: Computational approaches have been particularly valuable for studying UppP. For example, researchers have used molecular dynamics simulations to propose the carrier lipid-binding site of UppP .

  • Site-Directed Mutagenesis: This approach is crucial for validating computational models and identifying functionally important residues. By systematically mutating conserved amino acids in the predicted active site and measuring the resultant changes in enzymatic activity, researchers can confirm structural hypotheses.

  • Cryo-Electron Microscopy (Cryo-EM): As techniques improve, cryo-EM is becoming increasingly valuable for membrane protein structural studies, offering the advantage of analyzing proteins in a more native-like environment.

A combination of these techniques provides the most comprehensive structural understanding, as each method has its strengths and limitations.

How does UppP contribute to antibiotic resistance mechanisms?

UppP has been implicated in conferring low-level bacitracin resistance in several bacterial species. Bacitracin is an antibiotic that binds to undecaprenyl pyrophosphate, preventing its dephosphorylation and thereby inhibiting cell wall synthesis. Increased expression or activity of UppP can counteract this effect by accelerating the conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate, effectively reducing the target availability for bacitracin .

In Enterococcus faecalis, studies have directly identified UppP's role in mediating low-level bacitracin resistance. Gene inactivation studies showed that uppP mutants exhibited increased susceptibility to bacitracin compared to wild-type strains . This confirms that UppP activity contributes to the intrinsic resistance mechanisms against this antibiotic.

Additionally, given the essential nature of undecaprenyl phosphate in cell wall biosynthesis, alterations in UppP function can potentially affect susceptibility to other antibiotics that target cell wall synthesis, such as β-lactams and glycopeptides.

What makes UppP a potential target for novel antimicrobial development?

UppP represents an attractive target for novel antimicrobial development for several compelling reasons:

  • Essentiality: The undecaprenyl phosphate carrier is indispensable for bacterial cell wall synthesis in both Gram-positive and Gram-negative bacteria, making UppP functionally essential .

  • Conservation Across Species: The enzyme is highly conserved across bacterial species while having no close homologs in mammalian systems, offering the potential for broad-spectrum antibiotics with minimal host toxicity.

  • Structural Uniqueness: The active site of UppP contains unique structural motifs that can be specifically targeted by inhibitor molecules .

  • Synergistic Potential: Inhibitors of UppP could potentially act synergistically with existing antibiotics. For example, studies on inhibitors of the related enzyme undecaprenyl diphosphate synthase (UppS) have shown strong synergism with methicillin against methicillin-resistant Staphylococcus aureus (MRSA), with a fractional inhibitory concentration index (FICI) as low as 0.1 .

Recent screening efforts for inhibitors targeting the undecaprenyl pathway have identified several promising compounds with activity against drug-resistant pathogens, suggesting that UppP inhibitors could follow a similar pattern of effectiveness .

What are the current hypotheses regarding the catalytic mechanism of UppP?

Based on structural and functional studies, the following catalytic mechanism has been proposed for UppP:

  • Substrate Binding: The undecaprenyl pyrophosphate substrate binds to a pocket formed by the conserved (E/Q)XXXE and PGXSRSXXT motifs, with the hydrophobic undecaprenyl chain likely positioned within the membrane bilayer .

  • Metal Ion Coordination: Magnesium ions (Mg²⁺) play a crucial role in the catalytic process, coordinating with the conserved glutamate residues and the phosphate groups of the substrate .

  • Nucleophilic Attack: A water molecule, activated by either a conserved histidine residue or one of the glutamate residues, performs a nucleophilic attack on the phosphate bond of undecaprenyl pyrophosphate.

  • Product Release: Following dephosphorylation, the products (undecaprenyl phosphate and inorganic phosphate) are released from the active site.

The optimal pH for UppP activity is typically around 7.0, suggesting that neutral conditions are favorable for the proposed catalytic mechanism . Ongoing research using a combination of structural biology, site-directed mutagenesis, and computational approaches continues to refine this mechanistic understanding.

How should researchers address contradictory data when studying UppP activity?

When faced with contradictory data in UppP research, a systematic troubleshooting approach is essential:

  • Thoroughly Examine the Data: Carefully analyze all results to identify specific discrepancies and determine if they represent genuine contradictions or experimental artifacts .

  • Evaluate Initial Assumptions: Reassess the underlying hypotheses and experimental design. Consider whether the contradictions might be revealing unexpected properties of UppP or its interaction with experimental conditions .

  • Investigate Experimental Variables:

    • Detergent Effects: As a membrane protein, UppP activity is highly sensitive to detergent type and concentration. Try alternative detergents or mixed micelle systems.

    • Lipid Requirements: Consider whether specific lipids are required for optimal activity.

    • Cation Dependence: Test different concentrations and types of divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) as these can significantly affect enzyme activity.

    • Buffer Composition: Ionic strength and pH can dramatically influence membrane protein behavior.

  • Control Experiments: Implement additional controls to validate each step of the experimental process. For example, include well-characterized phosphatases as positive controls in activity assays.

  • Alternative Measurement Techniques: If one assay method produces contradictory results, employ complementary techniques to verify findings .

  • Consider Protein Quality: Verify protein folding and oligomeric state, as membrane proteins are particularly prone to aggregation or misfolding during recombinant expression.

When reporting contradictory results, ensure transparent documentation of all experimental conditions and variables to help the scientific community interpret and build upon your findings.

What are the critical factors for optimizing the expression of active recombinant UppP?

Optimizing the expression of active recombinant UppP requires careful attention to several critical factors:

  • Expression Host Selection: While E. coli is commonly used, alternative hosts like C41(DE3) or C43(DE3) that are specifically designed for membrane protein expression may yield better results for UppP.

  • Expression Vector Design:

    • Fusion Tags: Consider testing various fusion partners beyond the standard His-tag, such as MBP (maltose-binding protein) or SUMO tags, which can enhance solubility.

    • Signal Sequences: For membrane protein targeting, appropriate signal sequences may improve proper membrane insertion.

    • Promoter Strength: Tunable or weaker promoters often yield better results for membrane proteins than strong constitutive promoters.

  • Growth and Induction Conditions:

    • Temperature: Lower temperatures (16-20°C) typically favor proper folding of membrane proteins.

    • Inducer Concentration: Mild induction with lower IPTG concentrations (0.1-0.2 mM) often improves the quality of expressed membrane proteins.

    • Media Composition: Specialized media like Terrific Broth or media supplemented with glycerol can improve yield.

    • Growth Phase: Induction at higher cell densities (mid to late logarithmic phase) may be beneficial.

  • Membrane Extraction Conditions:

    • Detergent Selection: Systematic screening of detergents is crucial. n-Dodecyl-β-D-maltoside (DDM) at 0.02% has been successfully used for UppP , but others like CHAPS, digitonin, or lauryl maltose neopentyl glycol (LMNG) may be worth testing.

    • Solubilization Time and Temperature: Gentle, longer extractions at 4°C often preserve activity better than rapid, harsh extractions.

  • Storage Conditions:

    • Glycerol Content: 10-20% glycerol often stabilizes membrane proteins.

    • Reducing Agents: Addition of reducing agents like DTT or β-mercaptoethanol may prevent oxidative damage.

    • Protease Inhibitors: Especially important during early purification steps.

Systematic optimization and documentation of these parameters are essential for reproducible expression of active UppP.

How can researchers validate that their recombinant UppP retains native-like activity and structure?

Validating the native-like quality of recombinant UppP requires multiple complementary approaches:

  • Enzymatic Activity Characterization:

    • Kinetic Parameters: Compare the Km and kcat values of recombinant UppP with those reported for native enzyme where available. For UppP, substrate concentrations of 1× Km for FPP and 5× Km for IPP have been used as reference points for comparing enzyme activity across species .

    • pH Profile: Determine if the pH optimum matches expected values (typically around pH 7.0 for UppP) .

    • Cation Dependence: Verify the expected Mg²⁺ dependence of the enzyme.

  • Structural Integrity Assessment:

    • Circular Dichroism (CD): To evaluate secondary structure content.

    • Size Exclusion Chromatography: To confirm the expected oligomeric state.

    • Thermal Stability Assays: Such as differential scanning fluorimetry to assess protein stability.

    • Limited Proteolysis: Properly folded proteins typically show resistance to proteolytic digestion at specific sites.

  • Functional Validation:

    • Inhibitor Sensitivity: Test whether the recombinant enzyme responds to known inhibitors in the expected manner.

    • Substrate Specificity: Verify that the enzyme maintains expected substrate preferences.

    • Complementation Studies: If possible, test whether the recombinant UppP can complement UppP-deficient bacterial strains, restoring wild-type phenotypes.

  • Comparative Analysis:

    • Site-Directed Mutagenesis: Confirm that mutations in conserved residues affect activity as predicted. For UppP, mutations in the (E/Q)XXXE and PGXSRSXXT motifs should significantly impair activity if the recombinant protein retains native-like properties .

A combination of these approaches provides strong evidence for the native-like quality of the recombinant enzyme, increasing confidence in subsequent experimental findings.

What are the emerging techniques for studying UppP interactions with potential inhibitors?

Several cutting-edge approaches are advancing our understanding of UppP interactions with inhibitors:

  • Fragment-Based Drug Discovery (FBDD): This approach involves screening libraries of small molecular fragments (typically <300 Da) that can bind to different regions of UppP. Nuclear magnetic resonance (NMR) spectroscopy, surface plasmon resonance (SPR), and thermal shift assays can detect these weak interactions, which can then be optimized into more potent inhibitors.

  • Structure-Based Virtual Screening: Computational approaches utilizing the structural information of UppP have proven valuable for identifying potential inhibitors. For example, researchers have used crystal structures of the related enzyme UppS to validate virtual screening models, resulting in the identification of promising inhibitors with activity against resistant bacteria .

  • Cell-Based Screening Platforms: Innovative screening methods that enrich for inhibitors of the undecaprenyl pathway have been developed. One such platform exploits the link between wall teichoic acid inhibition and undecaprenyl phosphate production in Gram-positive organisms, enabling the identification of UppS inhibitors with selective properties .

  • Biophysical Techniques for Membrane Protein-Ligand Interactions:

    • Microscale Thermophoresis (MST): Allows measurement of interactions in solution with minimal protein consumption.

    • Isothermal Titration Calorimetry (ITC): Provides detailed thermodynamic parameters of binding.

    • Surface Plasmon Resonance (SPR): Offers real-time binding kinetics analysis.

These techniques collectively provide a multi-faceted approach to understanding UppP-inhibitor interactions and accelerating the development of novel antimicrobials targeting this essential enzyme.

How does UppP function within the broader context of bacterial lipid carrier cycling?

UppP plays a crucial integrative role within the complex lipid carrier cycling network in bacteria:

  • Carrier Lipid Recycling: After undecaprenyl-linked cell wall precursors deliver their cargo to the growing cell wall, UppP catalyzes the dephosphorylation of the resulting undecaprenyl pyrophosphate, regenerating undecaprenyl phosphate for subsequent rounds of cell wall synthesis . This recycling is essential because undecaprenyl phosphate is present in limited quantities in bacterial membranes .

  • Integration with Cell Wall Biosynthesis Pathways: UppP activity is coordinated with multiple cell wall synthesis pathways, including:

    • Peptidoglycan Synthesis: Undecaprenyl phosphate serves as the carrier for the assembly of peptidoglycan precursors, essential for cell wall integrity in both Gram-positive and Gram-negative bacteria .

    • Wall Teichoic Acid (WTA) Synthesis: In Gram-positive bacteria like Bacillus subtilis, undecaprenyl phosphate is utilized for the synthesis of WTA, initiated by the transfer of N-acetyl-glucosamine 1-phosphate by TagO .

    • Capsular Polysaccharide (CPS) and Lipopolysaccharide (LPS) Synthesis: In Gram-negative bacteria like Klebsiella pneumoniae, CPS and LPS synthesis begins with glycosyltransferases that transfer sugar-1-phosphate moieties from UDP-glucose or its derivatives onto undecaprenyl phosphate .

  • Regulatory Mechanisms: The activity of UppP must be precisely regulated to maintain the appropriate balance of undecaprenyl phosphate versus undecaprenyl pyrophosphate. Dysregulation of this balance can affect cell wall synthesis rates and antibiotic susceptibility .

Understanding UppP in this broader context is essential for developing targeted antimicrobial strategies that disrupt the entire carrier lipid cycle rather than just a single enzyme.

What genetic approaches are available for studying UppP function in Enterobacter species?

Several genetic approaches can be employed to study UppP function in Enterobacter species:

  • Gene Knockout and Complementation:

    • CRISPR-Cas9 System: Enables precise genome editing to create uppP deletion mutants.

    • Lambda Red Recombineering: Allows for efficient gene replacement in Enterobacteraceae.

    • Complementation Studies: Reintroduction of wild-type or mutant uppP genes on plasmids to validate phenotypes.

  • Controlled Expression Systems:

    • Inducible Promoters: Systems like arabinose-inducible (pBAD) or tetracycline-inducible promoters enable tight control of uppP expression levels.

    • Riboswitch-Based Control: Allows for fine-tuning of expression in response to specific ligands.

  • Reporter Gene Fusions:

    • uppP-lacZ Fusions: Similar to those used in E. faecalis studies, these fusions can monitor uppP expression under various conditions .

    • Fluorescent Protein Fusions: GFP or mCherry fusions can provide insights into UppP localization and expression dynamics.

  • 5'-RACE Analysis: This technique, previously employed to study uppP in E. faecalis, can identify transcription start sites and regulatory elements controlling uppP expression .

  • Transposon Mutagenesis Screens: Can identify genetic factors that influence UppP function or compensate for UppP deficiency.

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues in the active site can validate structural predictions and identify functionally important amino acids .

These genetic approaches, used in combination, can provide comprehensive insights into UppP function and regulation in Enterobacter species, potentially revealing species-specific characteristics and new therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.