Recombinant Enterobacter sp. Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for prioritized development.
Synonyms
arnC; Ent638_2078; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
arnC
Target Protein Sequence
MTKVEAIHKVSVVIPVYNEQESLPELIRRTTAACELLGKDYEILLVDDGSSDESASMLSD AAEEPGSHIVAVLLNRNYGQHNAIMAGFSHVTGDLIVTLDADLQNPPEEIPRLVAKADEG YDVVGTVRQNRQDTWFRKRASRLINRLIQSTTGKAMGDYGCMLRAYRRHIIDAMLHCHER STFIPILANTFARKAIEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRMLSVFG SIIAVLGFTLSVLLVVLRIAFGPQWAADGVFMLFAVLFMFIGAQFVAMGLLGEYIGRIYT DVRARPRYFIQRVVSRGSVSTSKENQQ
Uniprot No.

Target Background

Function

This recombinant Enterobacter sp. undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC) catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in bacteria?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) catalyzes the critical transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate in the bacterial inner membrane. This enzymatic activity is part of the lipopolysaccharide (LPS) modification pathway that confers resistance to polymyxin and other cationic antimicrobial peptides. The modified arabinose produced through this pathway is ultimately attached to lipid A, altering the bacterial cell surface charge and reducing the binding affinity of antimicrobial compounds .

How is arnC structurally classified and what are its key domains?

ArnC is classified as a type-2 glycosyltransferase (GT-2) based on sequence homology analysis. Recent structural characterization through cryo-EM single particle reconstruction has revealed that arnC contains critical inner helices (IH1/2) and a distinctive A-loop spanning residues 201-213 that undergoes conformational changes upon substrate binding. The protein features a conserved DxD motif (residues 100DADLQ104) characteristic of GT-2 enzymes that coordinates divalent cations for catalysis. This motif is essential for binding the diphosphate group of the sugar donor during the transfer reaction .

What expression systems are most effective for recombinant arnC production?

The most effective expression system for recombinant arnC production is E. coli, particularly when the protein is fused with an N-terminal His-tag to facilitate purification. Optimal expression conditions include:

ParameterOptimal Condition
Expression hostE. coli BL21(DE3)
Induction0.5 mM IPTG
Temperature18°C post-induction
Expression time16-18 hours
MediaTerrific Broth supplemented with appropriate antibiotics

When expressing membrane proteins like arnC, it's crucial to optimize detergent concentration during extraction and purification steps to maintain protein stability and activity. Commonly used detergents include n-dodecyl-β-D-maltoside (DDM) at 1% for extraction and 0.05% for purification steps .

What are the optimal conditions for assaying arnC enzymatic activity in vitro?

For optimal arnC activity assay conditions, researchers should implement the following protocol:

  • Buffer system: 50 mM HEPES pH 7.5, 150 mM NaCl, 10 mM MgCl2

  • Required substrates: UDP-4-deoxy-4-formamido-L-arabinose (UDP-L-Ara4FN) and undecaprenyl phosphate

  • Divalent cation: 1-5 mM Mn2+ (critical for activity)

  • Detergent: 0.02% DDM to maintain enzyme solubility

  • Temperature: 30°C

  • Reaction time: 30-60 minutes

Activity can be measured by monitoring either:

  • UDP release using a coupled enzymatic assay

  • Formation of undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose using HPLC or mass spectrometry

Researchers should consider including appropriate controls, such as heat-inactivated enzyme and reactions without key components, to validate assay specificity .

How can I design an effective power analysis for arnC inhibition studies?

Designing an effective power analysis for arnC inhibition studies requires careful consideration of several statistical and experimental parameters:

  • Define the primary outcome measure (e.g., percent inhibition, IC50 values)

  • Establish the minimal detectable effect size (MDE) based on previous studies or pilot data

  • Set significance level (α) typically at 0.05 and power level (1-β) at 0.80 or higher

  • Account for variance in enzyme activity measurements

For an experiment comparing multiple inhibitors in a dose-response format:

ParameterRecommended ValueJustification
Sample size per group6-8 replicatesBalances statistical power with resource constraints
Control groupsPositive and negativeEstablishes assay dynamic range
Technical replicates≥3 per biological sampleReduces measurement error
Statistical approachTwo-way ANOVA with Dunnett's post-hocAppropriate for multiple comparisons against control

If using regression discontinuity designs, note that sample sizes typically need to be 3-4 times larger than standard randomized designs to achieve equivalent statistical power .

What structural biology techniques are most informative for studying arnC conformational changes?

Multiple complementary structural biology techniques provide valuable insights into arnC conformational dynamics:

  • Cryo-EM single particle reconstruction: Most recently used to determine the structure of Salmonella typhimurium ArnC in both apo and UDP-bound states at 3.8Å resolution, revealing significant conformational changes in the A-loop (residues 201-213) and inner helices upon substrate binding .

  • X-ray crystallography: While challenging due to membrane protein crystallization difficulties, this approach can provide atomic-resolution structures when successful.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Valuable for mapping dynamics and solvent accessibility changes upon substrate binding.

  • Molecular dynamics simulations: Computational approach that complements experimental data to model conformational transitions and substrate interactions.

  • Site-directed spin labeling with EPR spectroscopy: Can probe specific domain movements in solution.

For comprehensive understanding, researchers should employ multiple techniques in combination, as each has distinct advantages and limitations for membrane protein analysis .

How should apparent contradictions in arnC structural data from different techniques be resolved?

Resolving contradictions in arnC structural data requires a systematic approach:

  • Evaluate experimental conditions: Different detergents, pH values, and buffer compositions can induce distinct conformational states. Create a detailed comparison table of experimental conditions across studies.

  • Consider resolution limitations: Compare the resolution limits of each technique (e.g., cryo-EM typically at 3-4Å versus X-ray crystallography potentially at <2Å) and assess whether apparent differences fall within resolution error margins.

  • Analyze functional states: Determine whether structures represent different functional states along the catalytic cycle rather than true contradictions.

  • Implement integrative modeling: Use computational approaches to develop models consistent with all experimental data, weighted by data quality and resolution.

  • Design validation experiments: Develop site-directed mutagenesis studies targeting residues with conflicting structural assignments and assess functional impacts.

When analyzing the recently published cryo-EM structure of Salmonella typhimurium ArnC (3.8Å), researchers should be particularly attentive to regions with partial disorder, such as residues G207 to K211, which could lead to ambiguous interpretations of the divalent cation position in the ArnC-UDP complex .

How does the tetrameric arrangement of arnC influence its catalytic function?

The tetrameric arrangement of arnC appears to play a significant role in its catalytic function through several mechanisms:

  • Conformational coupling: Recent cryo-EM structures reveal that UDP binding creates a more symmetrical tetrameric arrangement, suggesting cooperative effects between protomers. This is evidenced by the observation that "UDP binding symmetrizes the tetrameric arrangement as more similarities are observed in interfaces between ArnC protomers" .

  • Membrane interaction optimization: The tetrameric assembly likely positions the protein optimally within the bacterial inner membrane, creating a stable platform for catalyzing the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate.

  • Active site formation: The interfaces between protomers may contribute to the formation of complete active sites or influence substrate channeling.

  • Stability enhancement: Oligomeric assembly often enhances thermal and conformational stability of membrane proteins.

To experimentally investigate the functional significance of tetramerization, researchers should:

  • Design interface mutations to disrupt tetramer formation

  • Analyze both structural integrity and catalytic activity of resulting mutants

  • Perform complementation studies in arnC-deleted bacterial strains to assess functional significance in vivo .

What are the mechanistic differences between arnC proteins from different bacterial species?

Mechanistic differences between arnC proteins from different bacterial species represent an important area for comparative enzymology:

SpeciesKey Structural FeaturesCatalytic DifferencesAntimicrobial Resistance Implications
E. coliCanonical GT-2 foldReference standardPrimary model for polymyxin resistance
Salmonella typhimuriumRecently characterized by cryo-EM; contains distinctive A-loop (residues 201-213)Shows conformational changes in A-loop upon UDP bindingCritical for virulence and survival in host
Enterobacter sp.Higher sequence similarity to E. coli variant (64.23% identity with fosA5)Not fully characterizedEmerging clinical significance
Providencia rettgeriOften co-expressed with fosA11Potential synergistic activities with fosA-mediated resistanceMulti-drug resistance implications

Comparative analysis reveals species-specific variations in substrate specificity, catalytic efficiency, and inhibitor sensitivity. These differences may reflect adaptations to distinct ecological niches and antimicrobial exposure histories. Researchers should implement homology modeling and molecular dynamics simulations to predict functional consequences of sequence variations, followed by experimental validation through heterologous expression and enzymatic characterization .

How might substrate channeling occur between arnC and other enzymes in the L-Ara4N modification pathway?

Substrate channeling between arnC and other enzymes in the L-Ara4N modification pathway likely involves sophisticated spatial and temporal coordination:

  • Pathway organization: The amino arabinose biosynthetic pathway consists of enzymes encoded by the pmrE(ugd) and the arnBCDTEF operon. The sequential activities of Ugd, ArnA, and ArnB produce UDP-L-Ara4FN in the bacterial cytosol, which is then utilized by ArnC .

  • Membrane-cytosol interface: ArnC, as an integral membrane protein, likely positions its active site to efficiently receive UDP-L-Ara4FN from the terminal cytosolic enzyme (ArnB) and transfer the modified arabinose to undecaprenyl phosphate within the membrane.

  • ArnC-ArnD proximity: The product of ArnC (UndP-L-Ara4FN) must be efficiently transferred to ArnD deformylase, which catalyzes hydrolysis to UndP-L-Ara4N. The gene organization, with arnC and arnD adjacent in the operon, suggests potential co-localization and direct substrate transfer .

  • Transient complex formation: Biochemical and structural evidence suggests the formation of transient multi-enzyme complexes that enhance the efficiency of substrate transfer between pathway components.

To experimentally investigate substrate channeling, researchers should:

  • Perform pull-down assays to identify protein-protein interactions

  • Use FRET-based approaches to detect proximity between pathway components

  • Implement time-resolved enzymatic assays to detect kinetic signatures of channeling

  • Develop in vitro reconstitution systems with purified components to model the complete pathway .

How does the activity of arnC contribute to polymyxin resistance mechanisms?

The activity of arnC plays a crucial role in polymyxin resistance through the following mechanisms:

  • Modification of LPS charge: ArnC catalyzes a key step in the addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to lipid A phosphate headgroups. This modification reduces the negative charge of the bacterial outer membrane, decreasing the electrostatic attraction for cationic antimicrobial peptides like polymyxins .

  • Pathway integration: ArnC functions as the critical membrane-associated transferase that shifts the L-Ara4N modification pathway from the cytosol to the membrane environment. In polymyxin-resistant E. coli carrying the arn operon, deletion of the arnC gene decreases the level of UndP-Ara4FN, confirming its essential role in the resistance pathway .

  • Regulatory responses: Expression of arnC is induced under specific environmental conditions, including low Mg²⁺ and exposure to sublethal concentrations of antimicrobial peptides, as part of the PhoPQ and PmrAB two-component regulatory systems.

  • Cross-resistance implications: The L-Ara4N modification facilitated by ArnC confers resistance not only to polymyxins but also to other cationic antimicrobial peptides, including host-derived defensins, making it relevant for both therapeutic resistance and in vivo pathogen survival .

How can recombinant arnC be used to develop novel antimicrobial strategies?

Recombinant arnC provides several avenues for developing novel antimicrobial strategies:

  • Structure-based inhibitor design: The recent cryo-EM structure of Salmonella typhimurium ArnC in both apo and UDP-bound forms provides crucial structural information for rational design of selective inhibitors. Focus on:

    • The UDP binding pocket involving 14 amino acid residues from the ArnC IH1/2 and A-loop

    • The conserved DxD motif (residues 100DADLQ104) that coordinates divalent cations

    • Conformational changes induced by substrate binding

  • Combination therapies: ArnC inhibitors could be developed as adjuvants to restore polymyxin sensitivity in resistant strains, creating effective combination therapies against multidrug-resistant Gram-negative pathogens.

  • Diagnostic applications: Recombinant ArnC can be used to develop activity-based assays to detect and characterize resistance mechanisms in clinical isolates, enabling more targeted therapeutic approaches.

  • Vaccine development: As a conserved protein involved in virulence and antimicrobial resistance, recombinant ArnC or its derivatives could be explored as vaccine candidates against pathogenic Enterobacteriaceae.

  • Evolutionary analysis: Comparative studies of recombinant ArnC from multiple species can reveal evolutionary adaptations in response to antimicrobial pressure, informing strategies to counter resistance development.

When pursuing these strategies, researchers should implement rigorous experimental design with appropriate controls and power analysis to ensure reliable and reproducible results that can translate from in vitro studies to clinically relevant applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.