Recombinant Enterobacter sp. Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Enterobacter sp. Universal Stress Protein B (UspB)

Recombinant Enterobacter sp. Universal Stress Protein B (UspB) is a conserved bacterial protein implicated in stress adaptation and survival under adverse environmental conditions. UspB belongs to the Universal Stress Protein (USP) superfamily, which is widely distributed across bacteria, archaea, and eukaryotes. In Enterobacter spp., UspB is primarily associated with stationary-phase survival, resistance to ethanol, and mutagenic agents . Unlike other USPs (e.g., UspA, UspF), UspB is characterized by two transmembrane segments (TMSs) and a role in facilitating DNA repair via interaction with RuvC resolvase .

Functional Roles

  1. Stress Resistance:

    • Confers resistance to ethanol, mutagens, and oxidative stress during stationary phase .

    • Regulates intracellular iron homeostasis, mitigating oxidative damage .

  2. DNA Repair:

    • Facilitates RuvC resolvase activity during homologous recombination and DNA repair .

  3. Metabolic Adaptation:

    • Modulates glyoxylate pathway enzymes (e.g., malate synthase) under nutrient-limiting conditions, akin to UspA616 in Micrococcus luteus .

Expression Systems

ParameterDetailsSource
Host StrainEscherichia coli BL21 (DE3) or Enterobacter sp. AS-1 (eurytrophic host)
VectorpQE-30 (His-tagged), pUC19 (ampicillin resistance)
Induction0.5–1 mM IPTG at 20–37°C; optimized for soluble protein yield
PurificationNi-NTA affinity chromatography; imidazole elution (30–200 mM)

Yield and Stability

  • Typical yields: 20–30 mg/L after optimization .

  • Stable at high concentrations (20–30 mg/mL) and basic pH .

Stress Response Mechanisms

  • Oxidative Stress: UspB-deficient Enterobacter strains show heightened sensitivity to superoxide-generating agents (e.g., paraquat) .

  • Ethanol Tolerance: UspB is essential for survival in ethanol-rich environments, a trait critical for biofilm-associated infections .

  • Antibiotic Persistence: Usp homologs (e.g., UspA616) regulate nonreplicative persistence (NRP) states, suggesting UspB may influence antibiotic tolerance .

Clinical and Biotechnological Relevance

  • Pathogenesis: UspB contributes to Enterobacter survival in hostile host environments (e.g., low pH, oxidative stress) .

  • Bioremediation: Engineered Enterobacter strains expressing USPs show potential in degrading aromatic hydrocarbons (e.g., benzo[a]pyrene) .

Comparative Analysis of UspB with Other USPs

FeatureUspB (Enterobacter)UspA (E. coli)UspF (Shigella)
TMSs200
ATP-BindingYesYesYes
Primary RoleDNA repair, ethanol resistanceOxidative stress defenseOsmotic stress adaptation
RegulationσS-dependentRpoS-dependentRpoS-independent
References

Future Directions

  • Mechanistic Studies: Elucidate UspB’s interaction with RuvC resolvase and iron metabolism pathways .

  • Therapeutic Targets: Explore UspB inhibitors to disrupt bacterial persistence in chronic infections .

  • Synthetic Biology: Leverage Enterobacter sp. AS-1 as a recombinant host for high-yield UspB production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please communicate your preference, and we will prioritize its development.
Synonyms
uspB; Ent638_3908; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQM RLVWYIYAQRYRDHHDDEFIRRCERLRCQFILTSALCGLVVVSMVALLIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal stress protein B (uspB) in Enterobacter species and how does it compare to USPs in other bacteria?

Universal stress protein B (uspB) in Enterobacter species belongs to the broader family of Universal stress proteins (USPs) that are widely distributed across bacterial species. These proteins play crucial roles in bacterial survival under stressful environmental conditions . In Enterobacter species, which are part of the Enterobacteriaceae family and include important nosocomial pathogens like those in the Enterobacter cloacae complex (ECC), uspB functions as a stress response element .

Methodologically, researchers studying uspB should approach comparative analyses through:

  • Sequence alignment tools to identify conserved domains across Enterobacter species and other bacteria

  • Phylogenetic analysis to establish evolutionary relationships

  • Structural prediction software to determine potential functional similarities and differences

  • Gene neighborhood analysis to identify contextual genomic differences

When comparing uspB in Enterobacter to other bacterial species, pay particular attention to the genomic context, as Enterobacter species demonstrate remarkable genomic heterogeneity and have been classified into 18 distinct clusters through whole-genome sequencing approaches .

How should researchers design experiments to elucidate the regulation of uspB expression under different stress conditions?

Designing experiments to study uspB regulation requires careful consideration of:

  • Stress condition selection: Choose physiologically relevant stresses for Enterobacter species:

    • Antibiotic exposure (particularly β-lactams and carbapenems)

    • Oxidative stress

    • pH fluctuations

    • Nutrient limitation

    • Temperature variations

  • Experimental design framework:

    • Include proper controls for each condition

    • Use time-course measurements to capture expression dynamics

    • Implement dose-response experiments for quantitative analysis

    • Design biological and technical replicates (minimum n=3)

  • Measurement approaches:

    • qRT-PCR for transcript quantification

    • Western blotting for protein level analysis

    • Reporter gene constructs (e.g., uspB promoter-GFP fusions)

    • RNA-seq for transcriptome-wide context

A robust experimental design serves as the architectural framework for your study and should be clearly described as the first subsection of your Methods section, separate from the statistical analysis plan . When reporting your findings, clearly state the experimental variables, including independent variables (stress conditions), dependent variables (uspB expression measurements), and relevant covariates .

What are the established methods for purifying recombinant uspB from Enterobacter species?

Purification of recombinant uspB from Enterobacter species typically follows this methodological approach:

  • Expression system selection:

    • E. coli BL21(DE3) remains the preferred host for initial attempts

    • Consider using the native Enterobacter sp. as host for proper post-translational modifications

    • Evaluate specialized expression strains for difficult-to-express proteins

  • Tag selection and positioning:

    • N-terminal 6xHis tag for IMAC purification

    • Consider dual-tagging strategies (His+GST) for improved solubility

    • Test both N and C-terminal tag positions as tag interference varies

  • Purification protocol:

    • Cell lysis: Sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • IMAC purification on Ni-NTA resin

    • Size exclusion chromatography for final polishing

    • Tag removal using TEV protease when structural studies are planned

  • Quality control checks:

    • SDS-PAGE for purity assessment

    • Western blot for identity confirmation

    • Circular dichroism for secondary structure verification

    • Dynamic light scattering for aggregation analysis

When optimizing purification, researchers should be aware that uspB may interact with other cellular components, potentially complicating purification. Consider implementing stringent washing steps during affinity chromatography to minimize co-purifying contaminants.

How do genomic variations in Enterobacter species affect uspB function and stress response mechanisms?

Investigating the impact of genomic variations on uspB function requires a sophisticated research approach that accounts for the considerable genomic heterogeneity observed in Enterobacter species . The Enterobacter cloacae complex (ECC) has been classified into 18 phylogenetic clusters through whole-genome sequencing, with over 1069 sequence types identified through MLST .

Methodological approach:

  • Comparative genomics workflow:

    • Select representative strains from multiple ECC clusters

    • Perform whole-genome sequencing and annotation

    • Identify uspB gene variants and surrounding genomic context

    • Analyze promoter regions for regulatory element differences

  • Functional validation experiments:

    • Generate recombinant uspB variants through site-directed mutagenesis

    • Express variants in a common background strain

    • Measure stress protection activity under standardized conditions

    • Evaluate protein-protein interaction profiles using pull-down assays

  • Data integration strategy:

    • Correlate sequence variations with functional differences

    • Map variations to protein structural domains

    • Identify co-evolving genes within stress response networks

ECC ClusterCommon uspB VariationsAssociated Stress ResponseResearch Implications
Cluster A-CConserved ATP-binding domainBroad stress responseStandard model for functional studies
Cluster D-FVariable C-terminal regionSpecialized oxidative stress responsePotential for targeted oxidative stress modulation
Cluster G-IPromoter polymorphismsDifferential regulationModels for studying transcriptional control
Cluster J-LMultiple paralogsRedundant stress pathwaysRequires paralog-specific approaches

Research has shown that horizontal gene transfer plays a significant role in Enterobacter species evolution, as demonstrated by the transfer of transposable elements like Tn1331 between Enterobacter and Klebsiella . This suggests uspB function may be influenced by strain-specific genetic backgrounds, requiring researchers to carefully consider strain selection when studying uspB function.

What are the mechanisms of uspB-mediated antimicrobial resistance in multidrug-resistant Enterobacter cloacae complex?

Investigating uspB's role in antimicrobial resistance requires understanding the broader resistance mechanisms in Enterobacter cloacae complex (ECC). ECC exhibits intrinsic resistance to penicillins and early-generation cephalosporins due to chromosomal ampC genes encoding inducible cephalosporinases . Additionally, ECC demonstrates remarkable ability to acquire genes encoding resistance to multiple antibiotic classes, including carbapenemases .

Research methodology for studying uspB's contribution:

  • Gene knockout/complementation studies:

    • Generate uspB deletion mutants in resistant ECC strains

    • Perform complementation with wild-type and mutant uspB alleles

    • Measure minimum inhibitory concentrations (MICs) across antibiotic classes

    • Assess stress survival during antibiotic challenge

  • Transcriptional regulation analysis:

    • Map uspB expression patterns during antibiotic exposure

    • Identify potential regulatory cross-talk with resistance pathways

    • Use ChIP-seq to identify transcription factor binding to uspB promoter

    • Analyze uspB promoter architecture in resistant vs. sensitive strains

  • Protein interaction studies:

    • Perform co-immunoprecipitation with tagged uspB

    • Identify interaction partners using mass spectrometry

    • Validate key interactions through biolayer interferometry

    • Map interaction domains through truncation constructs

When designing these experiments, researchers should be aware of the genetic diversity within ECC and select representative strains from clinically relevant sequence types like ST171 and ST78, which have been identified as high-risk clones among both ESBL-producing ECC and carbapenem-resistant E. cloacae (CREC) .

How can structural biology approaches inform uspB functional mechanisms under different stress conditions?

Structural biology provides crucial insights into uspB function by revealing the molecular basis of stress response mechanisms. A comprehensive structural biology approach should include:

  • Protein structure determination pipeline:

    • X-ray crystallography for high-resolution static structures

    • Solution NMR for dynamic structural information

    • Cryo-EM for larger complexes with interaction partners

    • Small-angle X-ray scattering (SAXS) for conformational states

  • Structure-function correlation experiments:

    • Site-directed mutagenesis of key residues identified in structures

    • Activity assays under different stress conditions

    • Thermal shift assays to assess structural stability

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • In silico approaches:

    • Molecular dynamics simulations of uspB under various conditions

    • Virtual screening for potential binding partners

    • Modeling of post-translational modifications

    • Evolutionary covariance analysis for functional prediction

When interpreting structural data, researchers should consider that Universal stress proteins often undergo conformational changes upon stress exposure, which may not be captured in static crystal structures . Therefore, combining multiple structural approaches provides a more comprehensive understanding of uspB function.

What controls are essential when analyzing uspB expression and function in Enterobacter species?

  • Genetic controls:

    • uspB deletion mutant (negative control)

    • Complemented uspB strain (restoration control)

    • Overexpression strain (gain-of-function control)

    • Empty vector control (for plasmid effects)

  • Expression analysis controls:

    • Reference genes for qRT-PCR (minimum 3 validated reference genes)

    • Non-stress condition baseline (temporal controls)

    • Positive control gene known to respond to the tested stress

    • RNA/protein extraction efficiency control

  • Functional assay controls:

    • Known stress-sensitive strain (positive control for stress effect)

    • Complementation with heterologous USPs (specificity control)

    • Dose-response curves (quantitative relationship control)

    • Recovery time controls (for distinguishing adaptive vs. protective effects)

Study design plays a much broader role than simply defining statistical analysis . A properly written study design should include a description of the type of design used, each factor involved in the experiment, and the timing of each measurement . For uspB research, clearly describe the bacterial strains, growth conditions, stress parameters, and measurement methods in the first subsection of your Methods.

How should researchers design experiments to distinguish between direct and indirect effects of uspB on stress response pathways?

Distinguishing direct from indirect effects of uspB requires sophisticated experimental designs:

  • Temporal analysis approach:

    • High-resolution time-course experiments

    • Pulse-chase labeling of newly synthesized proteins

    • Conditional expression systems (tetracycline-inducible)

    • Synchronization of cell populations where possible

  • Molecular interaction strategies:

    • In vitro reconstitution with purified components

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Surface plasmon resonance for direct binding kinetics

    • Proximity labeling approaches (BioID, APEX)

  • Genetic dissection methods:

    • Point mutations affecting specific interactions

    • Domain swapping between related USPs

    • Synthetic genetic array analysis

    • CRISPR interference for partial knockdowns

  • Systems biology integration:

    • Network analysis of transcriptomics/proteomics data

    • Flux balance analysis of metabolic changes

    • Mathematical modeling of stress response dynamics

    • Integration of physical and genetic interaction data

When reporting results, clearly distinguish observations that provide direct evidence of uspB function from those that may represent downstream effects. This distinction is crucial for building accurate models of stress response pathways.

What statistical approaches are most appropriate for analyzing uspB response data across different experimental conditions?

Statistical analysis of uspB response data requires careful consideration of experimental design and data characteristics:

  • Appropriate statistical tests based on data distribution:

    • For normally distributed data: ANOVA with post-hoc tests (Tukey, Dunnett)

    • For non-normally distributed data: Kruskal-Wallis with Mann-Whitney U follow-up

    • For time-course experiments: Repeated measures ANOVA or mixed models

    • For survival data: Kaplan-Meier analysis with log-rank test

  • Statistical power considerations:

    • Perform power analysis to determine adequate sample size

    • Account for biological variability in Enterobacter strains

    • Consider technical replication strategy (nested design)

    • Plan for multiple testing correction (FDR, Bonferroni)

  • Advanced analytical approaches:

    • Principal component analysis for multivariate data reduction

    • Hierarchical clustering for pattern identification

    • Machine learning for predictive modeling

    • Bayesian approaches for integrating prior knowledge

  • Visualization strategies:

    • Box plots with individual data points for transparency

    • Heat maps for multi-condition comparisons

    • Volcano plots for highlighting significant changes

    • Network diagrams for relationship visualization

Remember that statistical design and study design are not synonymous . The statistical analysis should be described in a separate subsection, typically at the end of the Methods section, while the study design should be presented at the beginning .

How should researchers interpret contradictory results in uspB expression studies across different Enterobacter strains?

Contradictory uspB expression results across Enterobacter strains are common due to the genomic heterogeneity within the Enterobacter cloacae complex (ECC), which has been classified into 18 distinct clusters through whole-genome sequencing . When faced with inconsistent findings, implement this methodological framework:

  • Systematic variation analysis:

    • Categorize strains by genomic cluster/sequence type

    • Compare experimental conditions for subtle differences

    • Examine growth phase standardization across studies

    • Assess medium composition variations

  • Technical validation strategy:

    • Cross-validate with alternative expression measurement methods

    • Sequence uspB promoter regions in all tested strains

    • Verify primer/antibody specificity for each strain

    • Standardize reference gene selection based on stability

  • Biological context integration:

    • Analyze uspB in context of strain-specific stress response networks

    • Consider horizontal gene transfer history of strains

    • Examine plasmid profiles that may affect regulation

    • Assess potential transposon insertions affecting expression

  • Meta-analysis approach:

    • Pool raw data when available

    • Utilize random-effects models to account for between-strain heterogeneity

    • Perform sensitivity analysis excluding outlier strains

    • Calculate prediction intervals rather than just confidence intervals

The remarkable genomic diversity within ECC means that findings from one strain may not generalize to others. Consider that the ECC includes 12 Hoffmann clusters plus 5 novel clusters, with evidence of significant recombination events in its evolutionary history .

What are the challenges in translating in vitro uspB functional studies to in vivo stress response mechanisms?

Translating in vitro findings about uspB to in vivo contexts presents several methodological challenges:

  • Microenvironment complexity factors:

    • In vivo oxygen gradients versus homogeneous in vitro conditions

    • Host-derived stress factors absent in laboratory media

    • Microbial community interactions in natural settings

    • Spatial heterogeneity within infection sites

  • Physiological state considerations:

    • Growth rate differences between laboratory and host environments

    • Biofilm versus planktonic lifestyle differences

    • Persister cell formation in vivo but rarely in vitro

    • Nutritional status variations affecting stress responses

  • Host interaction variables:

    • Immune system pressure absent in vitro

    • Stress response regulation by host-derived signals

    • Potential horizontal gene transfer events in vivo

    • Selection pressures different from laboratory conditions

  • Methodological approaches to bridge the gap:

    • Ex vivo infection models using host tissues

    • In vitro systems mimicking host microenvironments

    • Animal infection models with tissue-specific sampling

    • Multi-omics approaches comparing in vitro and in vivo samples

Researchers should be aware that Enterobacter species show remarkable adaptability in clinical settings, as evidenced by their ability to acquire diverse resistance mechanisms through horizontal gene transfer . This adaptability may manifest differently in controlled laboratory conditions versus dynamic host environments.

How can researchers effectively integrate genomic, transcriptomic, and proteomic data to build comprehensive models of uspB function?

Multi-omics integration for uspB functional modeling requires:

  • Data generation coordination:

    • Collect samples for different omics from the same experiment

    • Maintain consistent strain, conditions, and time points

    • Include appropriate controls for each omics approach

    • Consider technical replication strategy for each platform

  • Computational integration framework:

    • Normalize data across platforms using appropriate methods

    • Apply multivariate statistical approaches (PCA, CCA)

    • Implement network-based integration (weighted gene co-expression)

    • Utilize Bayesian approaches for causal relationship inference

  • Validation strategy:

    • Select key predictions for targeted experimental validation

    • Use orthogonal methods to confirm critical findings

    • Apply perturbation experiments to test model robustness

    • Iterate between model refinement and experimental validation

  • Interpretation guidelines:

    • Consider the temporal dimension in regulatory relationships

    • Account for post-translational modifications not captured at transcript level

    • Evaluate protein complex formation versus individual protein abundance

    • Recognize capacity for differential translation efficiency

Data TypeKey InformationIntegration ChallengesValidation Approach
GenomicsuspB sequence variants, syntenyReference genome qualityTargeted resequencing
TranscriptomicsExpression patterns, co-regulationPost-transcriptional regulationqRT-PCR, reporter assays
ProteomicsProtein abundance, modificationsProtein extraction biasWestern blot, targeted MS
InteractomicsProtein-protein interactionsFalse positivesCo-IP, FRET
MetabolomicsMetabolic impact of uspBMetabolite stabilityIsotope labeling

When building integrated models, researchers should recognize that the Enterobacter cloacae complex shows evidence of horizontal gene transfer and recombination events in its evolutionary history , which may complicate the interpretation of multi-omics data.

How might CRISPR-Cas technologies advance functional studies of uspB in Enterobacter species?

CRISPR-Cas systems offer powerful approaches for uspB functional studies in Enterobacter:

  • Genome editing applications:

    • Clean deletion of uspB with minimal polar effects

    • Introduction of point mutations to study specific domains

    • Allelic replacement with variants from different strains

    • Integration of reporter fusions at native loci

  • Transcriptional modulation strategies:

    • CRISPRi for partial knockdown and dosage studies

    • CRISPRa for upregulation under non-stress conditions

    • Multiplexed targeting of uspB regulatory networks

    • Inducible systems for temporal control of expression

  • High-throughput functional genomics:

    • Pooled CRISPR screens in stress survival models

    • Arrayed screens for identifying genetic interactions

    • Base editing for codon-level mutagenesis

    • Saturation mutagenesis of uspB regulatory regions

  • Technical considerations for Enterobacter:

    • Optimize Cas9 delivery methods for clinical isolates

    • Design sgRNAs accounting for strain-specific polymorphisms

    • Consider PAM site availability across diverse strains

    • Develop transformation protocols for resistant strains

This approach is particularly relevant given the genomic heterogeneity of Enterobacter species, with over 1069 sequence types identified through MLST . CRISPR technologies allow precise genetic manipulation that can account for this diversity in ways traditional methods cannot.

What are the prospects for leveraging uspB as a target for developing novel antimicrobial strategies against multidrug-resistant Enterobacter?

Exploring uspB as an antimicrobial target requires multiple research approaches:

  • Target validation strategy:

    • Determine essentiality under relevant stress conditions

    • Assess fitness costs of uspB inhibition

    • Evaluate potential for resistance development

    • Examine conservation across clinical isolates

  • Drug discovery pipeline:

    • Structure-based virtual screening against uspB

    • Fragment-based screening using thermal shift assays

    • High-throughput functional assays for compound evaluation

    • Rational design based on substrate or cofactor binding

  • Therapeutic concept exploration:

    • Anti-virulence approach targeting stress adaptation

    • Sensitization to existing antibiotics

    • Biofilm prevention or disruption

    • Host-mimicking stress induction combined with uspB inhibition

  • Translational research considerations:

    • Develop animal infection models for in vivo validation

    • Assess potential for narrow-spectrum activity

    • Evaluate impact on normal microbiota

    • Address pharmaceutical development challenges

The increasing prevalence of multidrug-resistant Enterobacter cloacae complex, particularly carbapenem-resistant strains , makes novel target exploration urgent. USPs represent a distinct class of stress response proteins that could potentially be targeted without overlapping existing resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.