Recombinant Enterobacter sp. UPF0060 membrane protein Ent638_1931 (Ent638_1931)

Shipped with Ice Packs
In Stock

Description

Production Methods

Ent638_1931 is primarily produced in E. coli due to its cost-effectiveness and high yield . Alternative expression systems include:

Host SystemAdvantages
YeastFaster turnaround, moderate post-translational modifications
Insect CellsAdvanced folding and eukaryotic modifications (e.g., glycosylation)
Mammalian CellsFull post-translational processing for functional studies

For research requiring native-like folding or activity validation, insect or mammalian systems are recommended .

Applications in Research

  • Structural Studies: The protein’s small size (12.8 kDa) and solubility make it suitable for X-ray crystallography or NMR .

  • Antigen Development: Available in ELISA-ready formats for antibody production and immunoassays .

  • Membrane Protein Interaction Studies: Potential use in probing bacterial membrane dynamics, though its specific biological role remains uncharacterized .

Research Considerations

  • Functional Data Gap: No confirmed enzymatic or receptor activities are documented for Ent638_1931 .

  • Pathway Associations: Preliminary data suggest involvement in uncharacterized metabolic or regulatory pathways .

  • Interactome: Direct protein-protein interactions remain unexplored but could be studied via pull-down assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Ent638_1931; UPF0060 membrane protein Ent638_1931
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
Ent638_1931
Target Protein Sequence
MIKTTLLFFATALCEIIGCFLPWLWLKRGASVFLLLPAGIALALFVWLLTLHPAASGRVY AAYGGVYVCTALLWLRVVDGVKLSAYDWAGALVALCGMLIIVAGWGRT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.