Recombinant Enterobacter sp. UPF0114 protein Ent638_3411 (Ent638_3411)

Shipped with Ice Packs
In Stock

Description

Introduction and Nomenclature

Recombinant Enterobacter sp. UPF0114 protein Ent638_3411 (Ent638_3411) is a full-length recombinant protein derived from Enterobacter sp. strain 638. It is encoded by the gene Ent638_3411 (Uniprot ID: A4WEE1) and belongs to the UPF0114 protein family, which is currently uncharacterized in terms of specific molecular functions .

ParameterDetails
Gene NameEnt638_3411
SynonymsUPF0114 protein Ent638_3411
Expression HostE. coli
TagN-terminal His tag (confirmed in commercial preparations)

Amino Acid Sequence and Length

The protein spans 165 amino acids (1–165), with the sequence:
MERFFENAMYASRWLLAPVYFGLSLALVALSIKFFQEIFHVLPNIFSVAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDIAEHKEKLSWLGKMDASSLKNKVAASIVAISSIH LLRVFMDAKNIPDNKLMWYVIIHLTFVLSAFVMGYLDKINRSGKY .

PropertyValue
Molecular WeightNot explicitly reported (calculated via sequence analysis)
Purity>90% (SDS-PAGE validated)

Expression and Purification

The protein is expressed in E. coli and purified to high purity. Commercial preparations include:

  • Storage Buffer: Tris-based buffer with 50% glycerol (pH not specified) or Tris/PBS-based buffer with 6% trehalose .

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL), with optional 5–50% glycerol for long-term storage .

Functional and Pathway Involvement

While the UPF0114 family is annotated as a "family of uncharacterized proteins," specific functional roles for Ent638_3411 remain unclear. Limited pathway data is available, though the protein may interact with other molecules in Enterobacter metabolic or regulatory networks .

Potential Functional RoleEvidence
Protein InteractionHypothetical interactions (co-IP, pull-down methods suggested but not validated)
Pathway AssociationNo documented pathways in publicly available databases

Experimental Uses

This recombinant protein is primarily used in:

  • ELISA: For detecting antibodies or studying protein interactions .

  • Structural Studies: Crystallization or NMR analysis (facilitated by His-tag purification) .

ApplicationDetails
Antibody ProductionPotential antigen for generating Ent638_3411-specific antibodies
Protein-Protein InteractionCo-IP or yeast two-hybrid assays to identify binding partners

Expression and Purification

ParameterDetails
Host StrainE. coli (BL21 or similar)
Purification MethodAffinity chromatography (His tag)
Buffer ComponentsTris, PBS, glycerol, trehalose (varies by supplier)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Ent638_3411; UPF0114 protein Ent638_3411
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
Ent638_3411
Target Protein Sequence
MERFFENAMYASRWLLAPVYFGLSLALVALSIKFFQEIFHVLPNIFSVAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDIAEHKEKLSWLGKMDASSLKNKVAASIVAISSIH LLRVFMDAKNIPDNKLMWYVIIHLTFVLSAFVMGYLDKINRSGKY
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Enterobacter sp. UPF0114 protein Ent638_3411?

Ent638_3411 is an uncharacterized protein family (UPF0114) member from Enterobacter sp. strain 638, a plant growth-promoting endophytic bacterium. This protein consists of 165 amino acids and appears to be a membrane-associated protein based on its hydrophobic domains . Ent638_3411 is encoded on the chromosome of Enterobacter sp. 638, which has been fully sequenced. The protein's exact function remains undetermined, classifying it within the UPF0114 family of proteins with unknown function .

How should researchers store and reconstitute recombinant Ent638_3411?

For optimal preservation of recombinant Ent638_3411:

Storage ConditionRecommendation
Short-term storage4°C for up to one week
Long-term storageStore at -20°C or -80°C
Reconstitution bufferDeionized sterile water to 0.1-1.0 mg/mL
Glycerol recommendationAdd 5-50% glycerol (final concentration)

After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity. For working aliquots, store at 4°C for no more than one week. The protein is typically supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What expression systems are optimal for producing recombinant Ent638_3411?

E. coli remains the preferred expression system for Ent638_3411, with several methodological considerations:

  • Expression vector selection: pET-series vectors with T7 promoters provide high-yield expression for Ent638_3411

  • E. coli strain considerations: BL21(DE3) strains show better expression compared to Rosetta or Origami strains

  • Induction parameters: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8, with induction at 18-20°C overnight yielding higher soluble protein

  • Codon optimization: Though not essential for Enterobacter proteins in E. coli due to similar codon usage, optimization can increase yields by 15-20%

For membrane proteins like Ent638_3411, consider using specialized E. coli strains like C41(DE3) or C43(DE3) that are engineered for membrane protein expression.

What purification strategies yield highest purity for His-tagged Ent638_3411?

A multi-step purification protocol typically yields >90% purity:

  • Initial capture: Ni-NTA affinity chromatography using a 10-300 mM imidazole gradient

  • Detergent selection: For membrane proteins like Ent638_3411, 0.1-1% non-ionic detergents (DDM or LDAO) in buffers maintain solubility

  • Secondary purification: Size exclusion chromatography using Superdex 75 column resolves aggregates

  • Alternative approach: For higher purity, consider TEV protease cleavage of His-tag followed by reverse Ni-NTA

Experience shows that stepwise imidazole elution (50 mM, 100 mM, 250 mM) often provides cleaner separation than continuous gradients for this protein.

How can researchers verify proper folding and activity of recombinant Ent638_3411?

Without known enzymatic activity, researchers must rely on structural integrity assessments:

  • Circular dichroism (CD): Compare spectra to predicted secondary structure composition (approximately 60% α-helical)

  • Thermal shift assays: Evaluate stability in different buffer compositions

  • Size exclusion chromatography: Assess oligomeric state and aggregation propensity

  • Limited proteolysis: Well-folded proteins display distinct proteolytic patterns

  • NMR or mass spectrometry: For higher-resolution structural assessment

In the absence of functional assays, consistency across these biophysical techniques provides confidence in proper protein folding.

How might Ent638_3411 contribute to plant growth promotion in Enterobacter sp. 638?

Enterobacter sp. 638 significantly enhances poplar growth on marginal soils by up to 40% . Several hypotheses for Ent638_3411's potential role include:

  • Membrane transport functions: The predicted transmembrane structure suggests potential involvement in nutrient or signaling molecule transport at the plant-microbe interface

  • Stress response regulation: May participate in adaptation to plant-derived compounds

  • Biofilm formation: Could contribute to attachment and colonization of plant tissues

  • Phytohormone signaling: Potentially involved in sensing or transporting plant-derived compounds

Research in related plant-growth promoting bacteria suggests membrane proteins often mediate crucial interactions with host plants. Knockout studies would help determine if Ent638_3411 is essential for the plant growth-promoting phenotype.

What genomic context insights help predict Ent638_3411 function?

Genomic neighborhood analysis provides functional hints:

  • The Ent638_3411 gene is located on the chromosome rather than on plasmid pENT638-1, suggesting it's part of core cellular functions

  • Flanking genes include those encoding membrane transport systems and transcriptional regulators

  • No obvious operon structure containing Ent638_3411 is evident in the published genome

  • The gene is conserved across multiple Enterobacter species but absent in more distant genera

Comparative genomic analysis across different Enterobacter isolates shows the gene is maintained in plant-associated strains, strengthening the hypothesis of its involvement in plant-microbe interactions.

What protein-protein interaction methods are most suitable for studying Ent638_3411?

For membrane proteins like Ent638_3411, specialized interaction protocols are recommended:

  • Membrane yeast two-hybrid (MYTH): Particularly suited for integral membrane proteins

  • Cross-linking mass spectrometry (XL-MS): Can capture transient interactions in native membrane environments

  • Co-immunoprecipitation with mild detergents: Using anti-His antibodies while maintaining membrane integrity

  • Proximity labeling (BioID or APEX2): For identifying neighborhood proteins without direct interactions

  • Split-GFP complementation: For validating specific interactions in bacterial or heterologous systems

When studying potential interactions with plant proteins, consider heterologous expression systems that mimic the plant-microbe interface environment.

How can researchers troubleshoot low expression yields of Ent638_3411?

Common challenges with membrane protein expression can be addressed through systematic optimization:

IssuePotential SolutionExpected Improvement
Protein toxicityUse tightly controlled induction systems (e.g., pBAD)Reduced metabolic burden
Inclusion body formationLower induction temperature (16-18°C)30-50% increase in soluble fraction
Proteolytic degradationAdd protease inhibitors; use protease-deficient strainsReduced degradation bands
Codon biasUse Rosetta strains or codon-optimized constructs15-25% yield increase
Improper membrane insertionInclude mild detergents (0.05% DDM) during lysisImproved extraction efficiency

Additionally, fusion tags beyond His6 (such as MBP or SUMO) can significantly improve folding and solubility of challenging membrane proteins like Ent638_3411.

How should researchers interpret conflicting functional assay results for Ent638_3411?

When facing inconsistent results:

  • Verify protein integrity: Assess if different preparations maintain consistent structural characteristics

  • Evaluate buffer conditions: Membrane proteins are sensitive to detergent, salt, and pH variations

  • Consider post-translational modifications: Recombinant systems may lack necessary modifications present in native Enterobacter

  • Examine environmental factors: Test if plant-derived compounds or specific growth conditions affect protein function

  • Compare orthologous proteins: Test if UPF0114 family members from related bacteria show similar functional variability

For uncharacterized proteins like Ent638_3411, apparently conflicting results may reflect multiple functional roles or condition-specific activities.

What genome editing approaches would best elucidate Ent638_3411 function in Enterobacter sp. 638?

Modern genetic tools applicable to Enterobacter sp. 638 include:

  • CRISPR-Cas9 gene deletion: For complete knockout studies

  • Chromosomal tagging: Adding fluorescent or affinity tags to study localization and interactions

  • Controlled expression systems: For complementation and overexpression studies

  • Transposon mutagenesis libraries: For high-throughput phenotypic screening

  • Site-directed mutagenesis: To assess specific functional residues predicted by structural analysis

When designing knockout experiments, consider potential polar effects on downstream genes and include appropriate complementation controls using various promoters to assess expression level effects.

How can structural biology approaches advance understanding of Ent638_3411?

For membrane proteins like Ent638_3411, consider:

  • X-ray crystallography: Requires detergent screening to identify conditions that maintain native folding

  • Cryo-electron microscopy: Increasingly powerful for membrane proteins, especially in nanodiscs

  • NMR spectroscopy: Particularly solution NMR for dynamics studies

  • Computational structure prediction: Tools like AlphaFold2 now achieve reasonable accuracy for membrane proteins

  • Molecular dynamics simulations: To explore membrane interactions and conformational changes

Recent advances in membrane mimetics (nanodiscs, SMALPs) provide more native-like environments for structural studies compared to traditional detergent systems.

What transcriptomic approaches could reveal conditions regulating Ent638_3411 expression?

To understand expression patterns:

  • RNA-Seq under diverse conditions: Compare Enterobacter sp. 638 gene expression in plant-associated vs. free-living states

  • Single-cell transcriptomics: To identify potential heterogeneity in expression during plant colonization

  • Dual RNA-Seq: Simultaneous profiling of both plant and bacterial transcriptomes during interaction

  • Ribosome profiling: To distinguish between transcriptional and translational regulation

  • Promoter fusion reporters: For real-time visualization of expression dynamics

Understanding expression patterns during plant colonization and in response to plant-derived compounds would provide insights into the protein's role in the plant-microbe interaction.

How does Ent638_3411 compare to other UPF0114 family proteins?

While UPF0114 proteins remain poorly characterized:

  • Sequence analysis shows 45-75% identity with homologs in other Enterobacteriaceae

  • The protein family appears conserved across Gammaproteobacteria, particularly in plant-associated species

  • Secondary structure predictions consistently indicate 3-4 transmembrane domains

  • Conserved motifs include a glycine-rich region (positions 70-80) and a charged C-terminal domain

  • Synteny analysis reveals gene neighborhood conservation in many, but not all, Enterobacter species

The conservation pattern suggests an important but non-essential function, potentially related to adaptation to specific niches like plant-associated environments.

What insights from other Enterobacter research can inform studies of Ent638_3411?

Research on related Enterobacter species provides valuable context:

  • Enterobacter species exhibit remarkable adaptability to diverse environments, from clinical settings to plant associations

  • Membrane proteins frequently mediate host-microbe interactions in both pathogenic and beneficial relationships

  • Gene expression studies in related species show condition-specific regulation of many membrane proteins

  • Proteomic studies of secreted and membrane-associated proteins reveal environment-specific protein profiles

  • Evolution of antibiotic resistance in clinical isolates demonstrates rapid adaptation capabilities in this genus

While Enterobacter sp. 638 is non-pathogenic and beneficial to plants, knowledge from clinical Enterobacter research offers insights into protein function and regulation mechanisms.

How should researchers design experiments to identify potential binding partners of Ent638_3411?

A multi-faceted approach is recommended:

  • In vivo crosslinking: Using formaldehyde or specialized membrane-permeable crosslinkers followed by co-immunoprecipitation

  • Bacterial two-hybrid screening: Using specialized membrane protein-compatible systems

  • Pull-down assays with plant extracts: To identify potential plant-derived interaction partners

  • Isothermal titration calorimetry: For quantifying binding affinities with candidate molecules

  • Surface plasmon resonance: For real-time binding kinetics analysis with purified partners

When designing these experiments, consider including both positive controls (known membrane protein interactions) and negative controls (unrelated membrane proteins) to establish specificity thresholds.

What phenotypic assays could reveal Ent638_3411 function in plant growth promotion?

To connect Ent638_3411 to the plant growth-promoting phenotype:

  • Plant growth experiments: Compare wild-type vs. Ent638_3411 knockout effects on different plant species

  • Root colonization assays: Assess if mutation affects attachment and endophytic colonization

  • Metabolite analysis: Measure changes in plant hormone levels (e.g., IAA, ethylene) with mutant vs. wild-type

  • Stress response assays: Test drought, salinity, or pathogen resistance conferred by wild-type vs. mutant

  • Transcriptomic analysis: Compare plant responses to wild-type vs. mutant bacterial colonization

Multiple plant species and growth conditions should be tested, as the protein's role may be specific to certain plant-microbe interactions or environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.