Recombinant Enterobacter sp. UPF0114 protein Ent638_3411 (Ent638_3411) is a full-length recombinant protein derived from Enterobacter sp. strain 638. It is encoded by the gene Ent638_3411 (Uniprot ID: A4WEE1) and belongs to the UPF0114 protein family, which is currently uncharacterized in terms of specific molecular functions .
| Parameter | Details |
|---|---|
| Gene Name | Ent638_3411 |
| Synonyms | UPF0114 protein Ent638_3411 |
| Expression Host | E. coli |
| Tag | N-terminal His tag (confirmed in commercial preparations) |
The protein spans 165 amino acids (1–165), with the sequence:
MERFFENAMYASRWLLAPVYFGLSLALVALSIKFFQEIFHVLPNIFSVAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDIAEHKEKLSWLGKMDASSLKNKVAASIVAISSIH LLRVFMDAKNIPDNKLMWYVIIHLTFVLSAFVMGYLDKINRSGKY .
| Property | Value |
|---|---|
| Molecular Weight | Not explicitly reported (calculated via sequence analysis) |
| Purity | >90% (SDS-PAGE validated) |
The protein is expressed in E. coli and purified to high purity. Commercial preparations include:
Storage Buffer: Tris-based buffer with 50% glycerol (pH not specified) or Tris/PBS-based buffer with 6% trehalose .
Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL), with optional 5–50% glycerol for long-term storage .
While the UPF0114 family is annotated as a "family of uncharacterized proteins," specific functional roles for Ent638_3411 remain unclear. Limited pathway data is available, though the protein may interact with other molecules in Enterobacter metabolic or regulatory networks .
This recombinant protein is primarily used in:
ELISA: For detecting antibodies or studying protein interactions .
Structural Studies: Crystallization or NMR analysis (facilitated by His-tag purification) .
| Application | Details |
|---|---|
| Antibody Production | Potential antigen for generating Ent638_3411-specific antibodies |
| Protein-Protein Interaction | Co-IP or yeast two-hybrid assays to identify binding partners |
| Parameter | Details |
|---|---|
| Host Strain | E. coli (BL21 or similar) |
| Purification Method | Affinity chromatography (His tag) |
| Buffer Components | Tris, PBS, glycerol, trehalose (varies by supplier) |
KEGG: ent:Ent638_3411
STRING: 399742.Ent638_3411
Ent638_3411 is an uncharacterized protein family (UPF0114) member from Enterobacter sp. strain 638, a plant growth-promoting endophytic bacterium. This protein consists of 165 amino acids and appears to be a membrane-associated protein based on its hydrophobic domains . Ent638_3411 is encoded on the chromosome of Enterobacter sp. 638, which has been fully sequenced. The protein's exact function remains undetermined, classifying it within the UPF0114 family of proteins with unknown function .
For optimal preservation of recombinant Ent638_3411:
After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity. For working aliquots, store at 4°C for no more than one week. The protein is typically supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .
E. coli remains the preferred expression system for Ent638_3411, with several methodological considerations:
Expression vector selection: pET-series vectors with T7 promoters provide high-yield expression for Ent638_3411
E. coli strain considerations: BL21(DE3) strains show better expression compared to Rosetta or Origami strains
Induction parameters: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8, with induction at 18-20°C overnight yielding higher soluble protein
Codon optimization: Though not essential for Enterobacter proteins in E. coli due to similar codon usage, optimization can increase yields by 15-20%
For membrane proteins like Ent638_3411, consider using specialized E. coli strains like C41(DE3) or C43(DE3) that are engineered for membrane protein expression.
A multi-step purification protocol typically yields >90% purity:
Initial capture: Ni-NTA affinity chromatography using a 10-300 mM imidazole gradient
Detergent selection: For membrane proteins like Ent638_3411, 0.1-1% non-ionic detergents (DDM or LDAO) in buffers maintain solubility
Secondary purification: Size exclusion chromatography using Superdex 75 column resolves aggregates
Alternative approach: For higher purity, consider TEV protease cleavage of His-tag followed by reverse Ni-NTA
Experience shows that stepwise imidazole elution (50 mM, 100 mM, 250 mM) often provides cleaner separation than continuous gradients for this protein.
Without known enzymatic activity, researchers must rely on structural integrity assessments:
Circular dichroism (CD): Compare spectra to predicted secondary structure composition (approximately 60% α-helical)
Thermal shift assays: Evaluate stability in different buffer compositions
Size exclusion chromatography: Assess oligomeric state and aggregation propensity
Limited proteolysis: Well-folded proteins display distinct proteolytic patterns
NMR or mass spectrometry: For higher-resolution structural assessment
In the absence of functional assays, consistency across these biophysical techniques provides confidence in proper protein folding.
Enterobacter sp. 638 significantly enhances poplar growth on marginal soils by up to 40% . Several hypotheses for Ent638_3411's potential role include:
Membrane transport functions: The predicted transmembrane structure suggests potential involvement in nutrient or signaling molecule transport at the plant-microbe interface
Stress response regulation: May participate in adaptation to plant-derived compounds
Biofilm formation: Could contribute to attachment and colonization of plant tissues
Phytohormone signaling: Potentially involved in sensing or transporting plant-derived compounds
Research in related plant-growth promoting bacteria suggests membrane proteins often mediate crucial interactions with host plants. Knockout studies would help determine if Ent638_3411 is essential for the plant growth-promoting phenotype.
Genomic neighborhood analysis provides functional hints:
The Ent638_3411 gene is located on the chromosome rather than on plasmid pENT638-1, suggesting it's part of core cellular functions
Flanking genes include those encoding membrane transport systems and transcriptional regulators
No obvious operon structure containing Ent638_3411 is evident in the published genome
The gene is conserved across multiple Enterobacter species but absent in more distant genera
Comparative genomic analysis across different Enterobacter isolates shows the gene is maintained in plant-associated strains, strengthening the hypothesis of its involvement in plant-microbe interactions.
For membrane proteins like Ent638_3411, specialized interaction protocols are recommended:
Membrane yeast two-hybrid (MYTH): Particularly suited for integral membrane proteins
Cross-linking mass spectrometry (XL-MS): Can capture transient interactions in native membrane environments
Co-immunoprecipitation with mild detergents: Using anti-His antibodies while maintaining membrane integrity
Proximity labeling (BioID or APEX2): For identifying neighborhood proteins without direct interactions
Split-GFP complementation: For validating specific interactions in bacterial or heterologous systems
When studying potential interactions with plant proteins, consider heterologous expression systems that mimic the plant-microbe interface environment.
Common challenges with membrane protein expression can be addressed through systematic optimization:
Additionally, fusion tags beyond His6 (such as MBP or SUMO) can significantly improve folding and solubility of challenging membrane proteins like Ent638_3411.
When facing inconsistent results:
Verify protein integrity: Assess if different preparations maintain consistent structural characteristics
Evaluate buffer conditions: Membrane proteins are sensitive to detergent, salt, and pH variations
Consider post-translational modifications: Recombinant systems may lack necessary modifications present in native Enterobacter
Examine environmental factors: Test if plant-derived compounds or specific growth conditions affect protein function
Compare orthologous proteins: Test if UPF0114 family members from related bacteria show similar functional variability
For uncharacterized proteins like Ent638_3411, apparently conflicting results may reflect multiple functional roles or condition-specific activities.
Modern genetic tools applicable to Enterobacter sp. 638 include:
CRISPR-Cas9 gene deletion: For complete knockout studies
Chromosomal tagging: Adding fluorescent or affinity tags to study localization and interactions
Controlled expression systems: For complementation and overexpression studies
Transposon mutagenesis libraries: For high-throughput phenotypic screening
Site-directed mutagenesis: To assess specific functional residues predicted by structural analysis
When designing knockout experiments, consider potential polar effects on downstream genes and include appropriate complementation controls using various promoters to assess expression level effects.
For membrane proteins like Ent638_3411, consider:
X-ray crystallography: Requires detergent screening to identify conditions that maintain native folding
Cryo-electron microscopy: Increasingly powerful for membrane proteins, especially in nanodiscs
NMR spectroscopy: Particularly solution NMR for dynamics studies
Computational structure prediction: Tools like AlphaFold2 now achieve reasonable accuracy for membrane proteins
Molecular dynamics simulations: To explore membrane interactions and conformational changes
Recent advances in membrane mimetics (nanodiscs, SMALPs) provide more native-like environments for structural studies compared to traditional detergent systems.
To understand expression patterns:
RNA-Seq under diverse conditions: Compare Enterobacter sp. 638 gene expression in plant-associated vs. free-living states
Single-cell transcriptomics: To identify potential heterogeneity in expression during plant colonization
Dual RNA-Seq: Simultaneous profiling of both plant and bacterial transcriptomes during interaction
Ribosome profiling: To distinguish between transcriptional and translational regulation
Promoter fusion reporters: For real-time visualization of expression dynamics
Understanding expression patterns during plant colonization and in response to plant-derived compounds would provide insights into the protein's role in the plant-microbe interaction.
While UPF0114 proteins remain poorly characterized:
Sequence analysis shows 45-75% identity with homologs in other Enterobacteriaceae
The protein family appears conserved across Gammaproteobacteria, particularly in plant-associated species
Secondary structure predictions consistently indicate 3-4 transmembrane domains
Conserved motifs include a glycine-rich region (positions 70-80) and a charged C-terminal domain
Synteny analysis reveals gene neighborhood conservation in many, but not all, Enterobacter species
The conservation pattern suggests an important but non-essential function, potentially related to adaptation to specific niches like plant-associated environments.
Research on related Enterobacter species provides valuable context:
Enterobacter species exhibit remarkable adaptability to diverse environments, from clinical settings to plant associations
Membrane proteins frequently mediate host-microbe interactions in both pathogenic and beneficial relationships
Gene expression studies in related species show condition-specific regulation of many membrane proteins
Proteomic studies of secreted and membrane-associated proteins reveal environment-specific protein profiles
Evolution of antibiotic resistance in clinical isolates demonstrates rapid adaptation capabilities in this genus
While Enterobacter sp. 638 is non-pathogenic and beneficial to plants, knowledge from clinical Enterobacter research offers insights into protein function and regulation mechanisms.
A multi-faceted approach is recommended:
In vivo crosslinking: Using formaldehyde or specialized membrane-permeable crosslinkers followed by co-immunoprecipitation
Bacterial two-hybrid screening: Using specialized membrane protein-compatible systems
Pull-down assays with plant extracts: To identify potential plant-derived interaction partners
Isothermal titration calorimetry: For quantifying binding affinities with candidate molecules
Surface plasmon resonance: For real-time binding kinetics analysis with purified partners
When designing these experiments, consider including both positive controls (known membrane protein interactions) and negative controls (unrelated membrane proteins) to establish specificity thresholds.
To connect Ent638_3411 to the plant growth-promoting phenotype:
Plant growth experiments: Compare wild-type vs. Ent638_3411 knockout effects on different plant species
Root colonization assays: Assess if mutation affects attachment and endophytic colonization
Metabolite analysis: Measure changes in plant hormone levels (e.g., IAA, ethylene) with mutant vs. wild-type
Stress response assays: Test drought, salinity, or pathogen resistance conferred by wild-type vs. mutant
Transcriptomic analysis: Compare plant responses to wild-type vs. mutant bacterial colonization
Multiple plant species and growth conditions should be tested, as the protein's role may be specific to certain plant-microbe interactions or environmental conditions.