Recombinant Enterobacter sp. UPF0259 membrane protein Ent638_2284 (Ent638_2284)

Shipped with Ice Packs
In Stock

Description

Biological Source

  • Organism: Enterobacter sp. strain 638, isolated from poplar stems (Populus trichocarpa×deltoides) .

  • Gene: Encoded by the Ent638_2284 locus on the bacterial chromosome .

  • UniProt ID: A4WB73 .

Expression System

  • Host: Escherichia coli (E. coli) .

  • Form: Full-length recombinant protein (1-247 aa) fused with a His-tag .

Role in Plant Symbiosis

  • Phytohormone Production: Enterobacter sp. 638 promotes plant growth via acetoin and 2,3-butanediol synthesis, induced by sucrose .

  • Stress Adaptation: Encodes genes for oxidative stress resistance, chemotaxis, and adhesion to plant roots .

Membrane Protein Analysis

  • Crosslinking Studies: Advanced workflows (e.g., SMALP solubilization + XL-MS) achieved >80% sequence coverage for analogous bacterial membrane proteins, highlighting methods applicable to Ent638_2284 .

  • Structural Dynamics: Transmembrane domains often exhibit conformational flexibility, necessitating specialized techniques like native MS + DMT .

Key Research Findings

  1. Genomic Context: The Ent638_2284 gene is part of a genomic island linked to sucrose metabolism and phytohormone regulation .

  2. Stability: The protein’s storage stability is enhanced by trehalose, a cryoprotectant .

  3. Biotechnological Potential: Engineering Enterobacter sp. 638 could improve biofuel crop yields on marginal soils .

Analytical Challenges

  • Detergent Compatibility: Requires non-denaturing detergents (e.g., LMNG) for structural studies .

  • Post-Translational Modifications: No glycosylation reported, but disulfide bond mapping may be relevant for functional studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. We recommend contacting your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
Ent638_2284; UPF0259 membrane protein Ent638_2284
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
Ent638_2284
Target Protein Sequence
MSITAKSVYRDTGNFFRNQFITFLLIALLCALITVVLGHAFSPSDEQIASLSQGDNLAGS VGLFDLVQNMTPEQQQILLRASAASTFSGLIGNAIMAGGVLLMVQLVSAGQRVSALRAIG ASAPVLPKLFILIFLTTLLVQMGIMLVVVPGVLLAIILSFAPVMLVQDKMGIFTAMRSSI KLAWSNMRLVAPAVIGWLLAKTLLLLFAPNFAVLTPNIGAVVANTISNLISAVLLVYLFR LYTLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for preserving the stability of recombinant Ent638_2284?

For optimal stability of recombinant Ent638_2284, store the protein at -20°C in the provided storage buffer (Tris-based buffer with 50% glycerol). For extended storage periods, -80°C is recommended to minimize protein degradation. Working aliquots should be stored at 4°C and used within one week to maintain optimal activity.

Importantly, repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise protein integrity. To mitigate this risk, prepare single-use aliquots during initial handling. The storage buffer containing 50% glycerol has been specifically optimized for this membrane protein to minimize structural changes during the freezing process .

What expression systems are most effective for producing functional Ent638_2284 membrane protein?

Based on current research with similar membrane proteins, heterologous expression of Ent638_2284 is most successful using specialized bacterial expression systems. While standard E. coli BL21(DE3) strains can be used, C41(DE3) and C43(DE3) strains—derivatives specifically engineered for membrane protein expression—often provide superior yields with lower toxicity.

For optimal expression:

  • Use vectors containing mild promoters (e.g., pBAD) rather than strong promoters like T7

  • Lower induction temperature to 18-20°C

  • Reduce inducer concentration (0.1-0.5 mM IPTG)

  • Extend induction time (16-24 hours)

These modifications help minimize host cell stress responses that typically impair membrane protein production. Recent studies demonstrate that maintaining proper translocon function during overexpression is critical for successful membrane insertion .

What purification strategy yields the highest purity and structural integrity for Ent638_2284?

A multi-step purification approach is recommended:

  • Membrane fraction isolation: Perform cell lysis via sonication or French press in buffer containing protease inhibitors, followed by differential centrifugation (10,000×g to remove debris, then 100,000×g to collect membrane fraction)

  • Solubilization: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration (CMC)

  • Primary purification: Immobilized metal affinity chromatography (IMAC) using the protein's tag (typically His-tag)

  • Secondary purification: Size exclusion chromatography (SEC) to achieve highest purity

  • Buffer optimization: Final buffer should contain detergent at concentration slightly above CMC, with glycerol (10-20%) for stability

This strategy minimizes protein aggregation while preserving native conformation. Verification of structural integrity can be performed using circular dichroism to confirm secondary structure elements characteristic of membrane proteins .

What is currently known about the physiological function of UPF0259 membrane proteins in Enterobacter species?

The UPF0259 family of membrane proteins remains functionally enigmatic, as indicated by the "UPF" (Uncharacterized Protein Family) designation. Bioinformatic analyses suggest potential roles in:

  • Membrane integrity maintenance

  • Small molecule transport

  • Stress response signaling

Current research suggests these proteins are not primary virulence factors, as they were not identified among the prioritized immunogenic targets in comprehensive reverse vaccinology studies examining core proteomes of clinical Enterobacter species .

How can researchers evaluate potential interactions between Ent638_2284 and other bacterial membrane components?

To investigate protein-protein interactions involving Ent638_2284, researchers can employ several complementary approaches:

  • Co-immunoprecipitation with crosslinking: Use membrane-permeable crosslinkers like DSP (dithiobis(succinimidyl propionate)) to stabilize transient interactions before membrane solubilization

  • Bacterial two-hybrid assay: Modified for membrane proteins using split-ubiquitin systems

  • Surface plasmon resonance (SPR): Reconstitute purified protein in nanodiscs or liposomes for interaction studies with soluble partners

  • Mass spectrometry-based interactomics: Combine affinity purification with sensitive MS detection

  • FRET-based assays: Express fusion constructs with fluorescent proteins to detect proximity in vivo

When designing these experiments, consider that disrupting membrane integrity may alter native interactions. Control experiments with other characterized membrane proteins from Enterobacter species (such as the TonB-dependent receptors identified in immunogenic studies) provide valuable reference points .

How can Ent638_2284 be incorporated into model membrane systems for biophysical studies?

For biophysical characterization of Ent638_2284, several reconstitution approaches are available:

Reconstitution MethodAdvantagesBest ApplicationsTechnical Considerations
ProteoliposomesNative-like lipid bilayer environmentFunctional transport assaysRequires detergent removal; protein orientation may be random
NanodiscsDefined size, accessible from both sidesStructural studies, binding assaysRequires MSP (membrane scaffold protein) optimization
AmphipolsEnhanced stabilityCryo-EM, spectroscopic studiesLimited native lipid interaction
BicellesCompatible with solution NMRDynamics studiesTemperature-sensitive phase behavior

For optimal reconstitution, start with purified protein in DDM or LMNG detergent. The choice of lipid composition significantly impacts success - consider using E. coli polar lipid extract or defined mixtures mimicking Enterobacter membranes. Protein:lipid ratios typically range from 1:50 to 1:200 (w/w), with optimization required for specific applications.

Verification of successful incorporation can be achieved using negative-stain electron microscopy, dynamic light scattering, and functional assays appropriate to the suspected role of Ent638_2284 .

What methodologies are appropriate for evaluating membrane insertion and topology of Ent638_2284?

To experimentally determine the membrane topology of Ent638_2284:

  • Cysteine accessibility scanning: Introduce single cysteine residues throughout the protein sequence and probe accessibility using membrane-permeable vs. impermeable thiol-reactive reagents

  • Protease protection assays: Expose sealed membrane vesicles containing the protein to proteases, then identify protected fragments by mass spectrometry

  • GFP/PhoA fusion analysis: Create fusion proteins with reporters that function differently depending on their cellular location (cytoplasmic vs. periplasmic)

  • Cryo-EM or X-ray crystallography: For high-resolution structural determination, though challenging with membrane proteins

When designing constructs for topology studies, maintain the integrity of predicted transmembrane segments. Analysis software suggests Ent638_2284 likely contains multiple transmembrane helices, consistent with other UPF0259 family members.

The translocon machinery recognition of hydrophobic segments determines membrane insertion success. Understanding this process helps explain why certain membrane proteins express well while others do not, despite sequence similarity .

How does Ent638_2284 compare to other membrane proteins in the Enterobacteriaceae family regarding immunogenic potential?

Comprehensive immunogenic profiling studies of Enterobacter species have identified several membrane proteins with significant vaccine candidate potential. Based on quartile scoring methods that evaluate attributes such as subcellular localization, transmembrane helices, and antigenic properties, TonB-dependent receptors (including WP_058690971.1 and WP_008500981.1) rank among the highest potential immunogenic targets.

In comparative analysis:

Protein TypeRepresentative AccessionImmune Simulation (IFN-γ)TLR-4 Binding AffinityVaccine Potential
TonB-dependent receptorsWP_058690971.1370,000 ng/ml-68.984 kcal/molVery High
YjbH domain proteinsWP_110108068.1360,000 ng/ml-81.345 kcal/molVery High
Flagellar proteinsWP_033145204.1390,000 ng/ml-34.604 kcal/molModerate
UPF0259 family(Ent638_2284)Not determinedNot determinedUnknown

What are the most significant challenges in functional characterization of UPF0259 family proteins and current strategies to overcome them?

Functional characterization of UPF0259 family proteins faces several critical challenges:

  • Unknown substrate specificity: Without knowing the natural substrate, functional assays are difficult to design. Approaches to overcome this include:

    • Untargeted metabolomics comparing wildtype vs. knockout strains

    • Crosslinking with photoreactive amino acid analogs to trap transient interactions

    • Computational substrate docking simulations

  • Membrane protein expression toxicity: Overexpression often triggers stress responses in host cells, limiting yields. Strategies include:

    • Tight expression control using tunable promoters

    • C41/C43 E. coli strains engineered for membrane protein tolerance

    • Co-expression with chaperones specific for membrane proteins

  • Structural instability during purification: UPF0259 proteins may denature during extraction from native membranes. Solutions include:

    • Screening multiple detergent/lipid combinations

    • Native purification approaches (styrene maleic acid lipid particles)

    • Nanobody stabilization of flexible regions

  • Redundant functions in bacterial genomes: Functional knockout studies may show no phenotype due to compensatory mechanisms. Address by:

    • Creating multiple knockouts of related genes

    • Heterologous expression in systems lacking similar proteins

    • Stress condition screening to identify specific conditions requiring the protein

The combination of advanced genetic, biochemical, and computational approaches offers the most promising path to deciphering the functions of these enigmatic membrane proteins .

What are common issues encountered during recombinant expression of Ent638_2284 and corresponding solutions?

IssuePotential CausesSolutions
Poor expression yieldHost cell toxicity- Reduce induction temperature to 16-20°C
- Lower inducer concentration
- Switch to C41/C43 E. coli strains
- Use tightly regulated promoters
Protein aggregationImproper membrane insertion- Co-express with chaperones (e.g., DnaK-DnaJ-GrpE)
- Add chemical chaperones (e.g., glycerol, TMAO)
- Optimize translation rate with rare codon optimization
Degradation during purificationProtease activity- Include multiple protease inhibitors
- Maintain samples at 4°C throughout purification
- Consider fusion partners that enhance stability
Loss of function after purificationDetergent effects- Screen detergent panel (DDM, LMNG, DMNG, GDN)
- Add lipid during purification (0.1-0.5 mg/ml)
- Reconstitute into nanodiscs or proteoliposomes quickly

When optimizing expression conditions, monitor cell density closely, as decreased growth often indicates toxicity from membrane protein overexpression. Recent studies demonstrate that host cell stress responses significantly impact membrane protein production success, explaining why seemingly similar proteins can have drastically different expression profiles .

How can researchers differentiate between properly folded and misfolded states of Ent638_2284?

Distinguishing properly folded Ent638_2284 from misfolded forms is critical for meaningful functional studies. Implement these analytical approaches:

  • Size exclusion chromatography: Well-folded membrane proteins typically elute as monodisperse peaks, while aggregated forms elute in the void volume

  • Thermal stability assays: Properly folded proteins show cooperative unfolding transitions in differential scanning fluorimetry (DSF) with detergent-specific fluorescent dyes like CPM

  • Limited proteolysis: Correctly folded membrane proteins display characteristic proteolytic patterns, while misfolded variants show irregular digestion patterns

  • Circular dichroism spectroscopy: Secondary structure content (particularly α-helical content) provides insights into folding state

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence emission maxima shift based on local environment polarity, indicating folding state

When developing purification strategies, systematically test different detergents beyond standard DDM, including newer amphiphiles like GDN (glyco-diosgenin) that have shown superior performance with challenging membrane proteins. Additionally, incorporate analytical quality control steps throughout the purification process rather than only at the end to quickly identify conditions promoting proper folding .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.