Recombinant Enterobacter sp. UPF0266 membrane protein Ent638_2389 (Ent638_2389)

Introduction to Recombinant Enterobacter sp. UPF0266 Membrane Protein Ent638_2389

The Recombinant Enterobacter sp. UPF0266 membrane protein Ent638_2389, also known as Ent638_2389, is a recombinant protein derived from the Enterobacter species. This protein is of particular interest due to its role as a membrane protein and its potential applications in research and biotechnology. In this article, we will delve into the characteristics, production, and potential applications of this recombinant protein.

2.1. Protein Structure and Sequence

• Protein Length: The full-length protein consists of 152 amino acids (1-152aa) .

• Amino Acid Sequence: The sequence begins with MTVTDIVLVLFIVALLAYAFYDEFIMPRRNGETLLAVPLLRRGRVDAFIFAGLLAILIYN NVMSQGALLTTWLLCVLALMAFYLFWIRAPKIIFKSHGFFFANIWIEYNRIKEMNLSEDG VLVIQLEQRRLLVRVKNIDDLEKIYKIMVKTQ .

• UniProt ID: A4WBH8 .

2.2. Production and Expression

• Expression System: This protein is typically expressed in Escherichia coli (E. coli) .

• Tagging: The protein is often fused with an N-terminal His tag to facilitate purification .

2.3. Physical and Chemical Properties

• Form: Available as a lyophilized powder .

• Purity: Greater than 90% as determined by SDS-PAGE .

• Storage Buffer: Tris/PBS-based buffer with 6% trehalose, pH 8.0 . Alternatively, it can be stored in a Tris-based buffer with 50% glycerol .

Production and Purification

The production of recombinant Enterobacter sp. UPF0266 membrane protein Ent638_2389 involves the use of engineered E. coli strains. These strains are designed to optimize the expression and accumulation of membrane proteins by reducing cytotoxic effects associated with overexpression . The protein is purified using affinity chromatography, often facilitated by the His tag.

Potential Applications

While specific applications of this protein are not widely documented, recombinant membrane proteins like Ent638_2389 are generally used in research for studying membrane biology, protein function, and interactions. They can also serve as tools for developing diagnostic assays or as antigens in vaccine development.

5.2. ELISA Availability

This protein is available for use in ELISA assays, which can be crucial for detecting antibodies or antigens in various samples .

References Creative BioMart. Recombinant Full Length Enterobacter sp. UPF0266 Membrane Protein Ent638_2389 (Ent638_2389) Protein, His-Tagged. Frontiers in Microbiology. Enterobacter aerogenes and Enterobacter cloacae. PMC. Genomic characterization of an emerging Enterobacteriaceae species. CBM15. ELISA Recombinant Enterobacter sp. UPF0266 membrane protein Ent638_2389 (Ent638_2389). IJPCR. Increasing Trend of Enterobacter Species Infection in a Tertiary care. PMC. Inter-species diversity and functional genomic analyses of closed genome assemblies of clinically isolated, megaplasmid-containing Enterococcus raffinosus Er676 and ATCC49464. PubMed. High-level Production of Recombinant Membrane Proteins Using Escherichia coli.