Recombinant Enterobacter sp. UPF0442 protein Ent638_0521 (Ent638_0521)

Shipped with Ice Packs
In Stock

Description

Definition and Context

Ent638_0521 is annotated as a UPF0442 family protein, a classification typically assigned to hypothetical proteins of unknown function. The recombinant form is produced in Escherichia coli expression systems, tagged with hexahistidine (His) for purification, and corresponds to the full-length protein (residues 1–157) of the Ent638_0521 gene . Its UniProt identifier is A4W678, and it is associated with Enterobacter sp. strain 638, a Gram-negative bacterium within the Enterobacteriaceae family .

Production and Purification

Commercial production involves recombinant expression in E. coli, followed by affinity chromatography using His-tag purification. Specifications include:

ParameterDetails
Expression systemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized water or compatible buffers; glycerol (5–50%) for long-term storage

Sources:

Research Applications

While functional studies of Ent638_0521 are not publicly documented, its commercial availability suggests potential uses in:

  • Antibody development: As an immunogen for polyclonal or monoclonal antibody production.

  • Structural studies: For crystallization or NMR analysis due to its small size and solubility.

  • Pathogenicity research: Enterobacter spp. are opportunistic pathogens, and hypothetical proteins like Ent638_0521 may contribute to virulence mechanisms .

Limitations and Knowledge Gaps

  • Functional annotation: No experimental data on enzymatic activity, substrate binding, or interaction partners are available .

  • Pathway involvement: Public databases (e.g., KEGG, STRING) lack annotated pathways for Ent638_0521 .

  • Clinical relevance: Enterobacter sp. 638 is not directly linked to human disease, though related species exhibit antibiotic resistance and nosocomial infection potential .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we can accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, centrifuge the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the product with the specified tag.
Synonyms
Ent638_0521; UPF0442 protein Ent638_0521
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
Ent638_0521
Target Protein Sequence
MGIIEFLLALAQDMALSAIPAVGFAMVFNVPHRALRWCALLGAIGHGSRMVMMTAGFNIE WSTFMASMLVGCIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHFGYSEP QMILLLSNFLKASSIVGALSIGLSIPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Enterobacter sp. UPF0442 protein Ent638_0521?

Ent638_0521 is a hypothetical protein of unknown function belonging to the UPF0442 protein family. It originates from Enterobacter sp. strain 638, a Gram-negative bacterium within the Enterobacteriaceae family. The recombinant form corresponds to the full-length protein (residues 1-157) of the Ent638_0521 gene and has a UniProt identifier of A4W678. The protein is typically produced using Escherichia coli expression systems and is tagged with hexahistidine (His) for purification purposes.

The UPF0442 classification indicates that this is a protein of unknown function that shares sequence homology with other proteins in this family. Despite its uncharacterized nature, its conservation across bacterial species suggests potential biological significance that warrants investigation.

How does Ent638_0521 relate to other bacterial proteins?

Bioinformatic analyses suggest that Ent638_0521 shares sequence similarity with other UPF0442 family proteins across diverse bacterial species. Comparative genomic approaches indicate that homologs are present in multiple Enterobacter species with high sequence conservation. For instance, Enterobacter sp. AS-1, which has been characterized as a potential recombinant host, likely contains homologous proteins as suggested by its genomic profile with 4,921 predicted coding sequences .

Phylogenetic analyses based on 16S rRNA gene sequences have positioned various Enterobacter species in relation to one another. Enterobacter sp. AS-1, for example, exhibits similarities of 99.8% to E. sichuanensis WCHECL1597, 99.7% to E. chengduensis WCHECl-C4, 99.5% to E. wuhouensis WCHEs120002, and 99.3% to E. chuandaensis 90028 . These relationships provide context for understanding the evolutionary conservation of proteins like Ent638_0521 across the genus.

What are the optimal expression systems for Ent638_0521 production?

The optimal expression system for Ent638_0521 production depends on research objectives, but E. coli remains the most widely used host for this protein. When selecting an expression system, researchers should consider several factors:

E. coli-based expression:

  • BL21(DE3) strains are commonly used due to their reduced protease activity and compatibility with T7 promoter systems

  • Rosetta or Origami strains may improve expression if rare codons or disulfide bonds are present

  • The BL21-derived C41 and C43 strains show higher recombinant protein production with reduced acetate production, which can improve yield

Alternative expression systems to consider:

  • Eurytrophic hosts like Enterobacter sp. AS-1 show promise as recombinant hosts, particularly when minimal media or variable nutritional conditions are desired

  • For structural or functional studies requiring post-translational modifications, eukaryotic systems may be preferred, though no specific reports of Ent638_0521 expression in these systems exist

How does promoter selection impact Ent638_0521 expression?

Promoter selection significantly impacts recombinant protein expression levels, inducibility, and metabolic burden. For Ent638_0521 expression, several promoter systems can be considered:

PromoterCharacteristicsAdvantagesLimitations
T7Strong, highly inducible with IPTGHigh expression levels; tight regulationMetabolic burden; potential toxicity; leaky expression in some systems
trcModerate strength, IPTG-inducibleBalanced expression; reduced metabolic burdenLower yield than T7; some basal expression
tacSimilar to trc but slightly strongerGood balance of yield and regulationModerate basal expression
BADArabinose-inducibleFine-tunable expression; very tight regulationLower maximum yield; catabolite repression issues

Research has shown that metabolic burden associated with transcription and translation of foreign genes can decrease recombinant protein expression. The choice between high-copy-number plasmids (pMB1) and low-copy-number plasmids (p15A) also impacts expression levels and cellular stress .

What purification strategies yield the highest purity of Ent638_0521?

The standard purification strategy for recombinant His-tagged Ent638_0521 involves immobilized metal affinity chromatography (IMAC), but additional steps can enhance purity:

Primary purification (IMAC):

  • Equilibrate Ni-NTA or similar resin with binding buffer (typically 20-50 mM Tris-HCl pH 8.0, 300-500 mM NaCl, 10-20 mM imidazole)

  • Apply clarified cell lysate to the column

  • Wash with binding buffer containing incrementally higher imidazole concentrations (20-50 mM) to remove non-specifically bound proteins

  • Elute with elution buffer containing 250-500 mM imidazole

Secondary purification options:

  • Size exclusion chromatography (SEC) for removing aggregates and achieving higher purity

  • Ion exchange chromatography (IEX) as an orthogonal purification step

  • Hydrophobic interaction chromatography (HIC) for removing contaminants with different hydrophobicity profiles

Purification assessment:

  • SDS-PAGE analysis with Coomassie staining (target: >90% purity)

  • Western blotting using anti-His antibodies for specific detection

  • Mass spectrometry for identity confirmation

For long-term storage, the addition of 5-50% glycerol to purified protein samples is recommended to prevent freeze-thaw damage. Additionally, lyophilization in the presence of stabilizers like trehalose (6%) can maintain protein integrity during extended storage periods.

What approaches can determine the function of an uncharacterized protein like Ent638_0521?

Determining the function of an uncharacterized protein like Ent638_0521 requires a multi-faceted approach:

Computational prediction approaches:

  • Sequence homology analysis against characterized proteins

  • Structural homology modeling and comparison with known protein structures

  • Genomic context analysis (neighboring genes often have related functions)

  • Protein domain and motif identification

Experimental approaches:

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged Ent638_0521 as bait

    • Bacterial two-hybrid or yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

  • Gene knockout/complementation studies:

    • CRISPR-Cas9 or traditional homologous recombination methods to create knockout strains

    • Phenotypic analysis under various stress conditions

    • Complementation with wild-type gene to confirm phenotype

  • Biochemical assays:

    • General enzymatic activity screening (hydrolase, kinase, binding assays)

    • Substrate screening using metabolite arrays or biochemical libraries

    • Structural studies (X-ray crystallography, NMR) that might reveal potential active sites

  • Transcriptomic/proteomic profiling:

    • RNA-seq to identify co-regulated genes

    • Proteomics to identify changes in protein abundance in response to Ent638_0521 deletion

Based on the taxonomic context, investigation into potential roles in bacterial pathogenicity, stress response, or metabolic pathways could be particularly relevant, as Enterobacter species are known opportunistic pathogens with complex virulence mechanisms .

How can I investigate potential interaction partners of Ent638_0521?

Investigating protein-protein interactions for Ent638_0521 requires a systematic approach:

Affinity purification-mass spectrometry (AP-MS):

  • Express His-tagged or tandem affinity purification (TAP)-tagged Ent638_0521 in Enterobacter sp. or E. coli

  • Perform mild lysis to preserve protein complexes

  • Capture protein complexes via affinity chromatography

  • Identify binding partners using LC-MS/MS

  • Confirm interactions using reciprocal pull-downs or co-immunoprecipitation

Crosslinking-MS approaches:

  • Treat cells expressing Ent638_0521 with protein crosslinkers (e.g., formaldehyde, DSS)

  • Purify Ent638_0521 under denaturing conditions

  • Identify crosslinked peptides by MS/MS to map interaction interfaces

Bacterial two-hybrid system:

  • Clone Ent638_0521 into a bacterial two-hybrid bait vector

  • Screen against a prey library constructed from Enterobacter genomic DNA

  • Validate positive interactions through secondary screens

Co-expression studies:

  • Identify genes co-regulated with Ent638_0521 through transcriptomic analysis

  • Investigate co-occurrence patterns across bacterial genomes

  • Test for physical interactions between co-expressed proteins

Since Enterobacter species contain Type VI secretion systems (T6SS) as identified in Enterobacter sp. S-33 , investigating potential interactions between Ent638_0521 and T6SS components could be particularly informative if the protein functions in bacterial virulence or competitive fitness.

What structural analysis techniques are most suitable for Ent638_0521?

Several structural analysis techniques are suitable for characterizing Ent638_0521, with the choice depending on research objectives:

X-ray crystallography:

  • Advantages: High-resolution structure determination (potentially atomic resolution)

  • Approach: Screen crystallization conditions using commercial sparse matrix screens; optimize promising conditions; collect diffraction data; solve structure through molecular replacement or experimental phasing

  • Considerations: Requires relatively large amounts of pure, homogeneous protein; crystallization may be challenging

Nuclear Magnetic Resonance (NMR) spectroscopy:

  • Advantages: Structure determination in solution; dynamics information; interaction mapping

  • Approach: Express isotopically labeled protein (13C, 15N); collect multi-dimensional NMR spectra; assign resonances; calculate structure

  • Considerations: Size limitation (favorable for Ent638_0521 at 157 residues); requires high protein concentration and stability

Cryo-electron microscopy (cryo-EM):

  • Advantages: No crystallization required; visualization of protein complexes

  • Approach: Usually applied to larger complexes; may be suitable if Ent638_0521 forms larger assemblies

  • Considerations: Traditional single-particle cryo-EM has lower resolution for small proteins, though advances in microED are changing this

Small-angle X-ray scattering (SAXS):

  • Advantages: Low-resolution envelope in solution; information on oligomeric state

  • Approach: Collect scattering data at multiple concentrations; generate ab initio models

  • Considerations: Limited resolution; complementary to other methods

Circular dichroism (CD) spectroscopy:

  • Advantages: Rapid assessment of secondary structure content; thermal stability

  • Approach: Measure far-UV CD spectra; perform thermal denaturation

  • Considerations: Limited to secondary structure estimation; no atomic-level details

The small size of Ent638_0521 (157 amino acids) makes it particularly amenable to NMR structure determination, while its potential for crystallization also makes X-ray crystallography a viable option. A hierarchical approach beginning with CD spectroscopy for initial characterization, followed by more detailed structural analysis using either NMR or X-ray crystallography, would be most efficient.

How can Ent638_0521 be utilized in pathogenicity and virulence research?

While the specific role of Ent638_0521 in pathogenicity is not established, its study could contribute to understanding Enterobacter virulence mechanisms through several approaches:

Comparative genomics approach:

  • Compare the presence and sequence conservation of Ent638_0521 across pathogenic and non-pathogenic Enterobacter strains

  • Analyze genomic context for proximity to known virulence factors

  • Examine the protein's relationship to type VI secretion system (T6SS) components, as T6SS has been identified in Enterobacter species like S-33

Phenotypic characterization:

  • Generate knockout mutants lacking the Ent638_0521 gene

  • Assess changes in:

    • Biofilm formation capacity

    • Antibiotic resistance profiles

    • Survival under host-mimicking stress conditions

    • Cell surface hydrophobicity and co-aggregation properties (which can indicate pathogenic potential)

Host interaction studies:

  • Investigate Ent638_0521 mutant behavior in:

    • Adhesion to epithelial cell lines

    • Invasion assays

    • Persistence in macrophage models

    • Animal infection models (if appropriate)

Secretion and localization analysis:

  • Determine subcellular localization using fractionation and immunoblotting

  • Assess if Ent638_0521 is secreted under specific conditions

  • Evaluate potential interaction with host factors using pull-down assays

Recent genomic characterization of Enterobacter sp. S-33 revealed various virulence factors, including drug-efflux genes (acrA, acrB) and outer membrane proteins (OmpA, OmpC, OmpF) . Investigating whether Ent638_0521 interacts with these components could provide insights into its potential role in antibiotic resistance or membrane integrity.

What gene editing approaches are appropriate for Ent638_0521 functional studies?

Several gene editing approaches can be employed for functional studies of Ent638_0521 in Enterobacter sp.:

CRISPR-Cas9 system:

  • Design sgRNAs targeting Ent638_0521 with minimal off-target effects

  • Clone sgRNA into a CRISPR-Cas9 vector compatible with Enterobacter

  • Introduce a homology-directed repair template for gene deletion or modification

  • Screen transformants for successful editing

  • Verify edits by sequencing and phenotypic analysis

Traditional homologous recombination:

  • Create a knockout cassette with antibiotic resistance marker flanked by homology arms

  • Transform into Enterobacter using electroporation protocols optimized for species like AS-1

  • Select on appropriate antibiotics and screen for successful recombination

  • Confirm gene deletion using PCR and sequencing

Transposon mutagenesis:

  • Use Tn5 or similar transposon systems for random mutagenesis

  • Screen for colonies with transposon insertions in Ent638_0521

  • Characterize resulting mutants phenotypically

Plasmid-based approaches:

  • For complementation studies, clone wild-type Ent638_0521 into vectors like pUC19

  • For overexpression studies, use inducible promoters (T7, trc, tac, or BAD)

  • For protein localization studies, create fusion proteins with fluorescent tags

For transformation of Enterobacter species, electroporation has proven effective. The protocol used with Enterobacter sp. AS-1 (Gene Pulser II, Bio-Rad) allowed successful introduction of pUC19 plasmid, with transformants verified by their ability to form colonies on R2A + ampicillin medium . This approach could be adapted for introducing gene editing constructs targeting Ent638_0521.

How can I investigate the role of Ent638_0521 in bacterial stress responses?

Investigating the role of Ent638_0521 in stress responses requires a systematic approach comparing wild-type and mutant strains under various conditions:

Stress challenge experiments:

  • Generate Ent638_0521 knockout and complemented strains

  • Subject strains to various stressors:

    • Oxidative stress (H₂O₂, paraquat)

    • Acid stress (pH range 3-6)

    • Osmotic stress (high salt, sucrose)

    • Nutrient limitation (minimal media, carbon source restriction)

    • Antimicrobial compounds

  • Monitor growth rates, survival, and morphological changes

  • Quantify stress-specific markers (e.g., ROS levels, membrane integrity)

Transcriptomic and proteomic profiling:

  • Compare expression profiles of wild-type and Ent638_0521 mutants under:

    • Normal growth conditions

    • Various stress conditions

  • Identify differentially expressed genes/proteins

  • Perform pathway enrichment analysis to identify affected cellular processes

  • Validate key findings with RT-qPCR or targeted proteomic approaches

Protein localization and dynamics:

  • Create fluorescent protein fusions to track Ent638_0521 localization

  • Monitor changes in localization upon stress exposure

  • Assess protein-protein interactions under stress conditions

  • Measure protein turnover rates in different environments

Phenotypic microarray:

  • Use Biolog or similar systems to simultaneously test growth under hundreds of conditions

  • Identify specific conditions where Ent638_0521 contributes to fitness

  • Perform validation experiments for promising phenotypes

Enterobacter sp. AS-1's ability to grow on both rich media and water agar (containing no organic matter except agar) demonstrates adaptation to nutritional stress . Studying whether Ent638_0521 contributes to this eurytrophic capability could reveal its role in nutrient stress adaptation. Similarly, the motility behavior observed in Enterobacter sp. S-33, which contributes to persistence in stressed environments , might be influenced by proteins like Ent638_0521.

How can I optimize soluble expression of Ent638_0521?

Optimizing soluble expression of Ent638_0521 requires systematic adjustment of expression conditions:

Expression strain optimization:

  • Compare standard BL21(DE3) with specialized strains:

    • Rosetta strains for rare codon usage

    • Origami strains for disulfide bond formation

    • C41/C43 strains for potentially toxic proteins

    • Arctic Express for low-temperature expression

  • Consider Enterobacter sp. AS-1 as an alternative host, particularly if studying native function

Expression vector and promoter selection:

  • Test different promoter strengths (T7, trc, tac, BAD)

  • Compare high-copy (pMB1) vs. low-copy (p15A) plasmid backbones

  • Evaluate different fusion tags beyond His-tag (MBP, GST, SUMO) which can enhance solubility

Induction parameters optimization:

  • Test induction at different OD₆₀₀ values (0.5-1.0)

  • Try range of inducer concentrations:

    • IPTG: 0.1-1.0 mM

    • Arabinose: 0.002-0.2% for BAD promoter

  • Vary post-induction temperatures (18°C, 25°C, 30°C)

  • Test different expression durations (4h, 8h, overnight)

Media and growth conditions:

  • Compare rich media (LB, TB, 2xYT) with defined media

  • Test addition of solubility enhancers:

    • Sorbitol (0.5-1.0 M)

    • Glycine betaine (2.5 mM)

    • Low concentrations of ethanol (1-3%)

  • Consider auto-induction media for gradual protein expression

Co-expression strategies:

  • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

  • Co-express with foldases if disulfide bonds are present

The metabolic burden associated with recombinant protein expression often leads to decreased yield. To address this, systematic optimization of the expression system is crucial. Studies have shown that BL21 derivative strains like C41 can show higher recombinant protein production due to reduced acetate production and excretion to the extracellular medium .

What bioinformatic approaches can predict Ent638_0521 function?

Multiple bioinformatic approaches can be employed to predict the function of uncharacterized proteins like Ent638_0521:

Sequence-based predictions:

  • Homology detection:

    • BLAST against non-redundant protein databases

    • Position-Specific Iterated BLAST (PSI-BLAST) for remote homologs

    • Profile Hidden Markov Models (HMMs) using HMMER

  • Conserved domain analysis:

    • InterPro, CDD, SMART for identifying protein domains

    • Pfam for protein family classification

  • Motif identification:

    • PROSITE patterns for functional motifs

    • ELM for linear motifs

Structure-based predictions:

  • Structural modeling:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • I-TASSER or SWISS-MODEL for homology modeling

  • Structural comparison:

    • DALI or VAST+ for identifying structural homologs

    • ProFunc for structure-based function prediction

  • Binding site prediction:

    • 3DLigandSite for ligand binding site prediction

    • COFACTOR for enzyme active site prediction

Genomic context analysis:

  • Gene neighborhood analysis:

    • Examine consistently co-located genes across multiple genomes

    • Identify operonic structures

  • Gene fusion detection:

    • Identify domain fusions that suggest functional relationships

  • Phylogenetic profiling:

    • Identify proteins with similar phylogenetic distributions

Systems biology approaches:

  • Co-expression analysis:

    • Examine publicly available transcriptomic data

    • Identify genes with similar expression patterns

  • Protein-protein interaction prediction:

    • STRING database for predicted and known interactions

    • InterPreTS for structurally predicted interactions

For Ent638_0521, detailed genomic context analysis would be particularly valuable given the availability of complete genome sequences for multiple Enterobacter species, including AS-1 and S-33 . Comparative analysis of genomic neighborhoods across these genomes could reveal conserved gene clusters that provide functional hints.

How can I troubleshoot expression and purification issues with Ent638_0521?

Common issues in recombinant protein expression and purification can be systematically addressed:

Low expression yield troubleshooting:

  • Verify plasmid sequence integrity

  • Check for rare codons and consider codon-optimized constructs

  • Test different media formulations and growth conditions

  • Evaluate promoter strength and induction parameters

  • Monitor protein expression over time to identify optimal harvest point

  • Consider metabolic burden effects - lower copy number vectors or weaker promoters might increase yield

Insoluble protein/inclusion body troubleshooting:

  • Reduce induction temperature (16-20°C)

  • Decrease inducer concentration

  • Use solubility-enhancing fusion tags (MBP, SUMO)

  • Co-express with molecular chaperones

  • Develop inclusion body refolding protocol:

    • Solubilize in 8M urea or 6M guanidine-HCl

    • Perform stepwise dialysis to remove denaturant

    • Add appropriate redox agents if disulfide bonds are present

Purification troubleshooting:

  • His-tag binding issues:

    • Verify tag is not cleaved (Western blot)

    • Adjust imidazole concentration in binding buffer

    • Check metal ion leaching (recharge column)

    • Ensure proper pH (typically 7.5-8.0)

  • Protein aggregation:

    • Add stabilizing agents (glycerol, arginine)

    • Include reducing agents if appropriate

    • Optimize buffer conditions (pH, salt concentration)

  • Protein degradation:

    • Add protease inhibitors

    • Perform purification at 4°C

    • Minimize time between lysis and purification

    • Consider adding EDTA (if compatible) to inhibit metalloproteases

Protein activity issues:

  • Verify proper folding:

    • Circular dichroism spectroscopy

    • Fluorescence spectroscopy

    • Limited proteolysis

  • Check for inhibitory compounds:

    • Dialyze extensively to remove imidazole

    • Test different storage buffers

  • Assess oligomeric state:

    • Size exclusion chromatography

    • Dynamic light scattering

For successful purification of recombinant Ent638_0521, maintaining the protein in Tris/PBS buffer with 6% trehalose as a stabilizer has been reported to be effective. Additionally, avoiding repeated freeze-thaw cycles and adding glycerol (5–50%) for long-term storage can help preserve protein integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.