Recombinant Enterobacter sp. Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Transport Mechanism and Ion Selectivity

ZntB mediates Zn²⁺ uptake coupled with H⁺ transfer, as demonstrated by pH-dependent transport assays. Key findings include:

Mechanistic Model

  1. Proton Gradient Stimulation: Zn²⁺ uptake is driven by an inward H⁺ gradient, confirmed by experiments with proton ionophores (e.g., FCCP).

  2. Hydrated Ion Transport: Zn²⁺ is transported in its fully hydrated state, acting as an ion channel rather than requiring binding to the protein.

  3. Electrostatic Guidance: Cl⁻ ions within the pore stabilize Zn²⁺ passage by neutralizing positive charges.

Key Experimental Evidence

ExperimentObservationImplication
pH Gradient AssaysZn²⁺ uptake increases under acidic extracellular conditions.Proton-coupled import mechanism
Cryo-EM Structural DataSymmetrical pentamer in apo state; no Zn²⁺ binding observed.Transport via pore conformational changes
Mutagenesis StudiesDisruption of H⁺-binding residues (e.g., H168) abolishes transport.Critical role of H⁺ in Zn²⁺ translocation

Physiological Roles and Pathogenic Significance

ZntB is critical for zinc homeostasis and bacterial virulence, particularly in pathogens:

Functions in Bacteria

RoleMechanismPathogenic Impact
Zn²⁺ ImportMaintains intracellular Zn²⁺ concentrations under zinc-limited conditions.Enables survival in host environments.
Oxidative Stress DefenseZn²⁺ regulates antioxidant enzymes (e.g., superoxide dismutase).Protects pathogens from host immune response.
Toxin RegulationZn²⁺ homeostasis affects toxin production (e.g., E. coli Shiga toxins).Modulates virulence factor expression.

Target for Antimicrobials

  • Rationale: Disrupting ZntB function could deplete intracellular Zn²⁺, impairing bacterial viability.

  • Challenges: ZntB’s structural uniqueness (e.g., Cl⁻-enriched pore) complicates inhibitor design.

Evolution of Understanding

PeriodKey FindingsSource
Early StudiesMisclassified as Mg²⁺ channel due to CorA homology.
2017–2020Cryo-EM structures reveal symmetrical pentamer; transport assays confirm Zn²⁺/H⁺ symport.
2024Review highlights ZntB’s distinct mechanism compared to CorA and ZIP transporters.

Unresolved Questions

  1. Conformational States: How do pH and Zn²⁺ gradients trigger pore opening/closing?

  2. Selectivity Mechanism: Why does ZntB exclude other divalent cations despite a broad pore?

  3. Pathogen-Specific Roles: Is ZntB upregulated in host environments to scavenge Zn²⁺?

ZntB vs. Other Zn²⁺ Transporters

TransporterFamilyDirectionEnergy SourceMetal Specificity
ZntBMIT (CorA)ImportH⁺ gradientZn²⁺-selective
CorAMITImportNone (channel)Mg²⁺, Co²⁺, Zn²⁺
ZnuABCABCImportATPZn²⁺
ZntAP-type ATPaseExportATPZn²⁺

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; Ent638_2144; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Enterobacter sp. (strain 638)
Target Names
zntB
Target Protein Sequence
MEGIKGSEVNVPDAVFAWLLDGKGGARHLEDNDVIDSEHPCWLHLNYTHPDSAQWLASTP LLPNNVRDALAGDSVRPRVSRLGDGTLITLRCINGSTDERPDQLVAMRLYMDERLIVSTR QRKVLALDDVVNDLKEGTGPADCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQH IPPRGSLALLRKQLIVMRRYMTPQRDVYARLASERLSWMTDDQRRRMQDIADRLGRGLDE IDSCIARTAVMSDEIAQVMQESLSRRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGYQ FGFSAFCIMLVVLIGGVAWWLHRSKWL
Uniprot No.

Target Background

Function

Mediates zinc ion efflux.

Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and what is its primary function in bacterial systems?

ZntB belongs to the CorA Metal Ion Transporter (MIT) family but has evolved specific functional characteristics for zinc transport rather than magnesium transport. The protein is widely distributed among the proteobacteria of the α-, β-, and γ-subgroups, though it appears in fewer taxa compared to corA genes . In some bacterial species such as Silicibacter pomeroyi, Idiomarina loihiensis, the Vibrio group, and Magnetococcus, ZntB homologues are the only 2-TM-GxN type proteins present, with CorA orthologues apparently lacking .

How does the structure of ZntB contribute to its function?

ZntB forms a pentameric structure that spans the bacterial membrane, with each monomer contributing to the formation of a central pore through which zinc ions can pass . The protein consists of a large cytoplasmic domain and a transmembrane domain. The cytoplasmic domain forms a funnel-like structure that serves as the initial recognition site for zinc ions .

Key structural features include:

  • A pentameric assembly similar to CorA family members

  • A GVN motif instead of the GMN signature motif found in most CorA family members

  • Multiple zinc binding sites identified in crystal structures, including:

    • A zinc ion coordinated by two adjacent H41 residues (possibly non-physiological)

    • A second zinc ion located on the funnel surface, coordinated by C94 in β5 and H159 in α5

    • A third zinc ion bound within the wall of the pentamer, coordinated by H168 and C246

Unlike CorA, ZntB does not collapse into a highly asymmetrical state upon depletion of divalent cations, suggesting a distinct transport mechanism . The full-length structure of ZntB from Escherichia coli, determined by cryo-electron microscopy at 4.2 Å resolution, has provided significant insights into how this protein facilitates zinc transport across the membrane .

What experimental techniques are essential for studying ZntB function?

Research on ZntB has employed several complementary techniques to elucidate its structure and function. These methodologies are crucial for researchers aiming to study ZntB or similar transporters:

  • Structural determination methods:

    • Cryo-electron microscopy (cryo-EM) for full-length protein structure determination

    • X-ray crystallography for high-resolution structures of the cytoplasmic domain

  • Functional assays:

    • Isothermal titration calorimetry (ITC) to measure zinc binding affinity

    • Radio-ligand (⁶⁵Zn²⁺) uptake assays to measure transport activity in vitro

    • Fluorescent transport assays with reconstituted liposomes to monitor zinc transport

    • pH-dependent transport assays to assess the role of proton gradients

  • Genetic approaches:

    • Creation of knockout strains to assess the physiological role of ZntB

    • Complementation studies with wild-type alleles to confirm phenotypes

    • Site-directed mutagenesis to identify key residues involved in transport

  • Zinc sensitivity tests:

    • Disk diffusion analysis to assess cellular sensitivity to zinc

    • Growth characterization in varying zinc concentrations

These methodologies allow for comprehensive characterization of ZntB's transport properties, providing insights into its biological role and mechanism of action.

What is the controversy regarding ZntB's direction of transport?

There has been significant debate in the scientific literature regarding whether ZntB functions as a zinc importer or exporter. This controversy stems from conflicting experimental evidence:

Evidence for ZntB as an exporter:

  • Early studies in Salmonella enterica serovar Typhimurium suggested ZntB functions as a zinc and cadmium efflux system

  • Mutations at zntB rendered cells hypersensitive to the cytotoxic effects of zinc and cadmium, suggesting the protein mediates efflux of these cations

  • Direct analysis of transport activity in S. enterica identified a capacity for Zn²⁺ efflux, with expression of ZntB increasing the rate of ⁶⁵Zn²⁺ efflux 8.8-fold compared to a transport-deficient strain

Evidence for ZntB as an importer:

  • Analysis of ZntB regulation in Cupriavidus metallidurans revealed downregulation in the presence of high zinc, cadmium, and copper concentrations, suggesting an import function

  • The expression of homologous ZntB from Agrobacterium tumefaciens was not induced by treatments with zinc in concentrations ranging from 100 to 750 μM

  • Recent structural studies combined with transport assays demonstrate that ZntB mediates zinc uptake stimulated by a pH gradient across the membrane

The current scientific consensus, based on the most recent structural and functional characterization, indicates that ZntB primarily functions as a zinc importer, with its transport activity stimulated by a proton gradient across the membrane . This represents a significant shift from earlier classifications and highlights the importance of combining structural studies with functional assays to accurately determine transport directionality.

How does the transport mechanism of ZntB differ from CorA?

Despite belonging to the same protein superfamily, ZntB and CorA utilize distinct transport mechanisms. These differences are important for understanding the functional diversity within the CorA Metal Ion Transporter family:

FeatureZntBCorA
Primary substrateZinc (Zn²⁺)Magnesium (Mg²⁺)
Transport directionImport (recent evidence)Import (>95% of Mg²⁺ uptake)
Energy couplingProton-driven (pH gradient)Channel-like (no energy coupling)
Conformational changesMaintains relatively symmetrical stateCollapses into highly asymmetrical state upon divalent cation depletion
Signature motifGVN motifGMN motif
Transport regulationRegulated by zinc concentrationRegulated by magnesium concentration

The structural differences between ZntB and CorA reflect their distinct transport mechanisms. While CorA functions primarily as a channel allowing the diffusion of Mg²⁺ down its electrochemical gradient, ZntB appears to function as a secondary active transporter that couples zinc transport to the movement of protons . This fundamental difference in mechanism represents an evolutionary adaptation that allows ZntB to efficiently transport zinc, which has different coordination chemistry and cellular requirements compared to magnesium.

Furthermore, the conformational changes that occur during transport differ significantly between these proteins. CorA undergoes dramatic asymmetric rearrangements upon divalent cation depletion, while ZntB maintains a more symmetrical pentameric structure throughout its transport cycle .

What role does the proton gradient play in ZntB-mediated zinc transport?

Recent studies have demonstrated that ZntB-mediated zinc transport is stimulated by a pH gradient across the membrane, suggesting a proton-coupled transport mechanism . This represents a significant finding that helps explain how ZntB can function as a zinc importer despite the typically low concentrations of free zinc in bacterial environments.

The proton-driven zinc transport mechanism likely involves the following components:

  • Energy coupling: The proton gradient (ΔpH) across the bacterial membrane provides the energy needed to drive zinc uptake against its concentration gradient

  • Co-transport mechanism: ZntB appears to function as a Zn²⁺/H⁺ co-transporter, where the movement of protons down their electrochemical gradient is coupled to the uptake of zinc ions

  • pH sensitivity: Transport assays have demonstrated that zinc uptake via ZntB is enhanced under conditions where a proton gradient exists across the membrane

This proton-coupled transport mechanism differentiates ZntB from the channel-like function of its homologue CorA and explains how bacteria can efficiently acquire zinc even in environments where this essential nutrient is limited. The coupling to proton movement provides the thermodynamic driving force necessary for active transport of zinc into the bacterial cell.

What are the critical residues and domains involved in ZntB's transport mechanism?

Understanding the specific residues and structural elements that contribute to ZntB's transport function is essential for elucidating its mechanism and potentially designing inhibitors. Based on structural and functional studies, several key features have been identified:

  • Metal binding sites:

    • The cytoplasmic domain contains multiple zinc binding sites, including one coordinated by C94 and H159, and another coordinated by H168 and C246

    • These binding sites likely play roles in zinc recognition, transport regulation, or allosteric control

  • GVN motif:

    • Unlike the GMN motif found in most CorA family members, ZntB contains a GVN motif that may contribute to its zinc specificity

    • The substitution of methionine (M) with valine (V) likely alters the metal coordination properties of the filter region

  • Transmembrane helices:

    • The two transmembrane helices per monomer form the pathway through which zinc ions traverse the membrane

    • These helices contain residues that likely participate in zinc coordination during transport

  • Cytoplasmic funnel:

    • The large cytoplasmic domain forms a funnel-like structure that serves as the initial recognition site for zinc ions

    • The electrostatic properties of this funnel likely contribute to metal ion selectivity

Researchers interested in studying ZntB's transport mechanism should consider site-directed mutagenesis of these key residues to assess their contributions to zinc transport, binding affinity, and selectivity. Additionally, molecular dynamics simulations based on the available structural data could provide insights into the conformational changes that occur during the transport cycle.

What methods are optimal for expression and purification of recombinant ZntB?

For researchers working with recombinant ZntB, optimizing expression and purification protocols is crucial for obtaining sufficient quantities of functional protein for structural and biochemical studies. Based on published research, the following approaches have proven successful:

Expression systems and conditions:

  • Bacterial expression: E. coli is the most commonly used expression system for ZntB

    • BL21(DE3) or similar strains are suitable hosts

    • Expression from a pET-based vector under the control of a T7 promoter

    • Induction with IPTG at concentrations of 0.1-0.5 mM

    • Growth at lower temperatures (16-20°C) after induction to enhance proper folding

  • Membrane protein considerations:

    • Use of specialized E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Co-expression with chaperones may enhance proper folding

    • Addition of zinc to the growth medium (1-10 μM) may stabilize the protein

Purification strategy:

  • Membrane preparation:

    • Cell lysis by sonication or high-pressure homogenization

    • Membrane isolation by ultracentrifugation

    • Solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG))

  • Affinity purification:

    • Use of polyhistidine tags for immobilized metal affinity chromatography (IMAC)

    • Purification under mild conditions to maintain protein stability

    • Inclusion of low concentrations of zinc (1-5 μM) in all buffers

  • Size exclusion chromatography:

    • Final purification step to isolate the pentameric form

    • Assessment of oligomeric state and homogeneity

  • Protein reconstitution for functional studies:

    • Reconstitution into liposomes using established protocols

    • Verification of proper orientation in the membrane

    • Optimization of lipid composition for functional studies

Careful attention to these expression and purification parameters will increase the likelihood of obtaining functional ZntB suitable for downstream applications including structural studies, biochemical characterization, and transport assays.

How can researchers design experiments to resolve conflicting data on ZntB function?

The literature on ZntB contains conflicting data regarding its transport direction and mechanism. To address these discrepancies, researchers should consider comprehensive experimental approaches that combine multiple techniques:

  • Complementary transport assays:

    • Perform both uptake and efflux assays using radiolabeled zinc (⁶⁵Zn²⁺)

    • Conduct assays in both whole cells and reconstituted proteoliposomes

    • Control for the contribution of other zinc transporters by using knockout strains

  • Manipulation of driving forces:

    • Systematically vary the zinc concentration gradient

    • Manipulate the membrane potential using ionophores

    • Alter the pH gradient to assess proton coupling

    • Test the effects of competing divalent cations

  • Direct measurement of proton coupling:

    • Use pH-sensitive fluorescent dyes to monitor proton movement

    • Measure pH changes associated with zinc transport

    • Apply proton uncouplers to disrupt proton gradients

  • Structural studies under different conditions:

    • Obtain structures in the presence and absence of zinc

    • Capture different conformational states of the transport cycle

    • Use crosslinking approaches to trap specific conformations

  • Comprehensive mutational analysis:

    • Target residues implicated in zinc binding and transport

    • Create chimeric proteins between ZntB and other transporters

    • Perform random mutagenesis coupled with functional screening

Experimental ApproachAdvantagesLimitations
Radiolabeled zinc transport assaysDirect measurement of zinc movementRequires radioisotope handling facilities
Reconstituted proteoliposome assaysControlled environment, eliminates other transportersMay not reflect in vivo conditions
pH gradient manipulationTests proton coupling hypothesisMultiple factors can affect pH gradients
Structural studiesProvides mechanistic insightsStatic snapshots, may miss intermediate states
MutagenesisIdentifies critical residuesLabor-intensive, may affect protein stability

By combining these approaches and carefully controlling experimental variables, researchers can generate more definitive data regarding ZntB's transport direction and mechanism, helping to resolve the current contradictions in the literature.

What is the role of ZntB in bacterial virulence and pathogenesis?

  • Host-pathogen zinc competition:

    • During infection, host organisms attempt to sequester zinc at the host-pathogen interface to reduce bacterial virulence

    • Pathogens employ specific uptake systems, potentially including ZntB, to scavenge zinc in these restricted environments

    • Conversely, in some infection contexts, hosts may elevate zinc concentrations to toxic levels, requiring bacterial export systems

  • ZntB in Enterobacteriaceae:

    • Several membrane transporters involved in zinc homeostasis in Enterobacteriaceae are linked to virulence

    • As a zinc transporter widely distributed in Enterobacteriaceae, ZntB likely contributes to maintaining appropriate intracellular zinc levels during infection

  • Research approaches to investigate ZntB's role in virulence:

    • Construction of zntB deletion mutants in pathogenic bacteria

    • Virulence assays comparing wild-type and ΔzntB strains

    • Gene expression analysis of zntB during infection

    • In vivo imaging to track zinc distribution in host-pathogen interactions

For researchers interested in this aspect of ZntB function, experimental approaches should include:

  • Infection models using zntB mutant strains

  • Competition assays between wild-type and mutant bacteria in vivo

  • Transcriptomic analysis of zntB expression under infection-relevant conditions

  • Assessment of zinc acquisition in environments mimicking the host-pathogen interface

Understanding the contribution of ZntB to bacterial virulence could potentially identify new targets for antimicrobial development, particularly in cases where zinc acquisition is critical for pathogen survival within the host.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.