Recombinant Enterobacteria phage f1 Attachment protein G3P (III)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-424
Protein Length
Full Length of Mature Protein
Species
Enterobacteria phage f1 (Bacteriophage f1)
Target Names
III
Target Protein Sequence
AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPI GLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPAN PNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAY WNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSE GGGSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAID GFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFVFG AGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES
Uniprot No.

Target Background

Function

Recombinant Enterobacteria phage f1 Attachment protein G3P (III) plays crucial roles in both viral genome penetration into the bacterial host via pilus retraction and in virion extrusion. Initially, G3P mediates phage adsorption to the F-pilus tip. Subsequent interaction with the host entry receptor, TolA, facilitates viral DNA penetration into the host cytoplasm. During extrusion, G3P's C-terminal domain mediates the release of the membrane-anchored virion from the cell.

Protein Families
Inovirus G3P protein family
Subcellular Location
Virion. Host membrane; Single-pass type I membrane protein. Note=Prior to assembly, G3P is found associated with the bacterial host inner membrane. There are about five copies of this protein per mature phage that are located on the head side of the filamentous virion.

Q&A

What is the domain organization of G3P and how does it relate to phage infection?

G3P (gene 3 protein) is a minor coat protein from filamentous Ff bacteriophages (M13, fd, and f1) that consists of three distinct domains: N1, N2, and CT (C-terminal domain). The N2 domain specifically interacts with the bacterial F pilus, serving as the primary receptor binding domain. The N1 domain, connected to N2 by a flexible glycine-rich linker, forms a complex with the C-terminal domain of the bacterial membrane protein TolA during later stages of infection. This sequential interaction is essential for the phage infection process. The CT domain is integrated into the phage coat and connects the N-terminal domains to the virion .

The infection pathway involves a two-step receptor recognition process where the N2 domain first binds to the F pilus, followed by a conformational change that allows the N1 domain to interact with TolA, ultimately facilitating phage entry into the host cell. This structural arrangement enables the phage to specifically target bacterial cells expressing the appropriate receptor complexes .

How does the structural organization of G3P contribute to its functional versatility?

The G3P protein exhibits a sophisticated structural organization that enables its multifunctional capabilities. The N1 domain possesses a six-stranded beta barrel structure topologically identical to a permutated SH3 domain but uniquely capped by an additional N-terminal alpha helix . This specific architecture provides both stability and flexibility to the protein. The N1 and N2 domains form a horseshoe arrangement with extensive disordered linker regions that allow for considerable conformational freedom .

Recent cryo-electron microscopy studies have revealed that while the primary filamentous region of the phage is highly ordered, the N1-N2 domains of G3P appear as knob-like structures connected to the virion by flexible linkers. This arrangement enables these domains to adopt various orientations surrounding the main body of the phage's pointy tip, facilitating the protein's ability to engage with different receptor molecules during the infection process .

What experimental evidence supports the current model of G3P-mediated phage infection?

The current model of G3P-mediated phage infection is supported by multiple lines of experimental evidence. Crystal structure analyses have provided detailed insights into the protein's domain organization and how these domains interact with host receptors. The crystal structure of the complex between G3P N1 and TolA D3 was obtained by fusing these domains with a long flexible linker, revealing an interface of approximately 1768 Ų of buried molecular surface .

Mutation studies have further validated this model, demonstrating that alterations in the G3P domains affect infection efficiency. For example, research has shown that NdC83 (an internal deletion mutant) exhibits a dominant-negative effect on virion infectivity when combined with wild-type G3P . Additionally, complementation experiments revealed that while the complete C domain (lacking only N1-N2) could complement the assembly deficiency of the NdC83 mutant, it could not restore its infectivity . These findings differentiate the triggers and conformational transitions involved in phage entry and release processes, providing robust support for the sequential binding model of phage infection.

How do the structural differences between G3P N2 and TolA D3 domains impact their competitive binding to the N1 domain?

Despite both G3P N2 and TolA D3 domains interacting with the same region of the G3P N1 domain, they exhibit entirely different folds leading to distinctive interdomain contacts. Crystallographic studies have revealed that during the infection process, the TolA D3 domain displaces the G3P N2 domain from its interaction with N1 . This displacement occurs despite the lack of topological similarity between TolA D3 and G3P N2.

The competitive binding mechanism likely involves allosteric effects and differential binding affinities. The interface between G3P N1 and TolA D3 corresponds to approximately 1768 Ų of buried molecular surface, indicating a substantial interaction area . The structural arrangement allows us to understand how initial interactions between the G3P N2 domain and the F pilus trigger conformational changes that enable the G3P N1 domain to form a complex with TolA. This structural understanding provides insights for designing experiments to modulate phage infectivity through targeted modifications of these interaction interfaces.

What are the charge distribution patterns on G3P, and how do they influence phage assembly and infection?

Recent structural analyses have revealed distinct charge separation patterns on the filamentous phage surface that significantly impact its biological functions. The N domains and pointy tip of G3P (pIII) are predominantly negatively charged, while the phage lumen displays an overwhelmingly positive charge due to the C-terminus of pVIII . This electrostatic arrangement creates a polarized structure that influences both assembly and host interaction processes.

The phage surface and lumen are lined with hydrophilic residues, with hydrophobic residues mediating interactions between individual protein subunits . This amphipathic character enables the phage to maintain structural integrity in various environments while facilitating the conformational changes necessary for infection. Understanding these charge distribution patterns is crucial for designing experiments that manipulate phage stability and infectivity through targeted modifications of the electrostatic landscape.

How do the recently identified structural features of G3P explain previously observed phenotypes of mutant phages?

The structural features of G3P recently identified through cryo-electron microscopy have provided molecular explanations for previously observed phenotypes of mutant phages. For instance, the discovery that the round tip measures only 6 nm (comprising merely 0.6% of the total filament length) while the pointy tip measures 17 nm (1.6% of the total wild-type filament) explains the dramatic effects that small mutations in these regions can have on phage function .

The observation that mixing different pIII mutants within a virion affects entry and release differently now has a structural basis. For example, the complete C domain (lacking only N1-N2) can complement the assembly deficiency of the NdC83 internal deletion mutant but not its lack of infectivity . Furthermore, the dominant-negative effect of NdC83 on virion infectivity when combined with wild-type pIII can be understood in terms of structural interference with the proper arrangement of functional domains. These structural insights have practical applications, having contributed to major improvements in phage-assisted continuous evolution (PACE) techniques .

What are the most effective methods for expressing and purifying recombinant G3P for structural studies?

The expression and purification of recombinant G3P for structural studies requires specialized approaches due to the protein's complex domain organization. A highly effective method involves using a two-plasmid system for generating f1-derived nanorods, which has been successfully employed in recent structural studies . This system consists of:

  • A nanorod template plasmid generating circular single-stranded DNA (approximately 529 nucleotides long)

  • A helper plasmid encoding all f1 phage proteins

When both plasmids are transformed into bacteria, the circular ssDNA is produced and subsequently packaged into short phage-like nanorod particles by the f1 proteins expressed from the helper plasmid. For enhanced stability, pVIII can contain a Y21M replacement that results in a more stable conformation of the major coat protein .

Purification of these nanorods typically follows a multi-step process:

  • Harvesting from bacterial culture medium

  • CsCl density gradient centrifugation

  • Anion exchange chromatography

This approach yields highly pure and structurally intact G3P-containing particles suitable for advanced structural analyses including cryo-electron microscopy and X-ray crystallography.

What strategies can be employed to engineer G3P for altered host specificity?

Engineering G3P for altered host specificity has been successfully accomplished through several strategic approaches. One effective method involves homologous recombination in bacterial hosts to modify the tail fiber genes that determine host range. For example, the creation of a hybrid T3/7 phage by replacing part of the tail fiber gene of T3 (gp17) with that of phage T7 resulted in a recombinant phage with broader host range and better adsorption efficiency than either of the wild-type phages .

Another approach involves identifying spontaneous mutations that confer expanded host range and then deliberately engineering these modifications into phage genomes. Le et al. demonstrated this by isolating a spontaneous mutant of phage JG004 with broader host range, identifying a single point mutation in the putative tail fiber gene (ORF84), and then replacing the homologous gene (ORF69) in phage PaP1 with this modified tail fiber gene through homologous recombination. This resulted in a chimeric phage capable of infecting a host strain that the wild-type phage could not infect .

These techniques can be combined with directed evolution approaches to develop phages with custom host specificities for various research and therapeutic applications.

How can researchers effectively modify G3P for phage display applications while maintaining structural integrity?

Modifying G3P for phage display applications requires careful consideration of structural constraints to maintain protein functionality. Based on structural studies, researchers have identified several effective strategies:

  • N-terminal fusions: Protein domains or peptides are often successfully fused to the N-termini of either the full-length G3P or the G3P C-terminal domain. This position is most permissive for modifications as it extends away from the phage body .

  • C-terminal fusions: Studies have shown that peptides can be linked to the C-terminus of G3P, though space limitations in the G3P central structure explain why only an extra 9 residues are tolerated in this position . Longer peptides fused to the G3P C-terminus can only be displayed on the phage surface if:

    • Combined with wild-type G3P in the same virion

    • A glycine linker is used to allow the peptide to pass between helices in the tip and become exposed on the exterior of the phage particle

  • Domain replacement: In some cases, researchers can replace entire domains while retaining function. For instance, the N1-N2 domains can be replaced with alternative binding domains if the flexible linker regions are preserved.

When designing G3P modifications, researchers should consider the charge distribution and hydrophobicity patterns of the native protein to ensure that the modified protein maintains proper folding and functionality within the phage structure.

How can G3P be engineered to create non-lytic, non-replicative phage variants for therapeutic applications?

Engineering G3P to create non-lytic, non-replicative phage variants for therapeutic applications represents an important advancement in phage therapy. One successful approach involves replacing key functional genes in the phage genome with genes encoding bactericidal proteins. For example, researchers modified the Pseudomonas aeruginosa filamentous phage Pf3 to become a non-lytic, non-replicative lethal variant (Pf3R) by replacing an export protein gene with the BglII endonuclease gene .

This engineering strategy demonstrated remarkable therapeutic efficacy:

  • In vitro studies showed that Pf3R reduced P. aeruginosa PAO1 CFU by 99% after 90 minutes of infection while maintaining minimal endotoxin release

  • In vivo experiments resulted in approximately 75% survival of mice treated with Pf3R after P. aeruginosa infection, while untreated mice and those treated with the original lytic phage (Pf3) did not survive

  • Inflammatory markers such as TNF-α and IL-6 were almost twice as high after infection with the original lytic phage compared to the recombinant phage

These results demonstrate that engineered phages can effectively treat bacterial infections while minimizing harmful endotoxin release, providing a promising avenue for developing targeted antimicrobial therapies.

What methodological approaches can be used to study the kinetics of G3P-receptor interactions?

Studying the kinetics of G3P-receptor interactions requires sophisticated biophysical techniques that can capture the dynamic nature of these molecular interactions. Several methodological approaches have proven particularly effective:

  • Surface Plasmon Resonance (SPR): This technique allows real-time measurement of binding affinities between purified G3P domains and their receptors (F pilus components or TolA). By immobilizing one partner on a sensor chip and flowing the other partner across the surface, researchers can determine association and dissociation rates as well as binding constants.

  • Isothermal Titration Calorimetry (ITC): ITC provides thermodynamic parameters of G3P-receptor interactions, including binding affinity, enthalpy changes, and stoichiometry. This approach is particularly valuable for understanding the energetics driving the sequential binding events during phage infection.

  • Fluorescence Resonance Energy Transfer (FRET): By labeling G3P domains and receptor proteins with appropriate fluorophore pairs, researchers can monitor conformational changes and binding events in real-time, providing insights into the dynamic aspects of these interactions.

  • Structural approaches: Combining X-ray crystallography with cryo-electron microscopy allows researchers to visualize different conformational states of the G3P-receptor complexes . These structural studies can be complemented with hydrogen-deuterium exchange mass spectrometry to identify regions of conformational flexibility during receptor binding.

These methodologies, often used in combination, provide comprehensive insights into the kinetics and mechanisms of G3P-receptor interactions that are essential for phage infection.

How can phage-assisted continuous evolution (PACE) be optimized using G3P variants?

Phage-assisted continuous evolution (PACE) can be significantly optimized through strategic engineering of G3P variants. The structure-function relationship of G3P provides multiple avenues for enhancing PACE systems:

  • Complementation strategies: Research has shown that combinations of different pIII mutants within a virion can have profound effects on phage functionality. For example, the complete C domain (lacking only N1-N2) complements the assembly deficiency of the NdC83 internal deletion mutant but not its lack of infectivity . These complementation effects have been the basis for major improvements in PACE systems.

  • Dominant-negative approaches: The observation that NdC83 has a dominant-negative effect on virion infectivity when combined with wild-type pIII provides a mechanism for controlling phage propagation in PACE systems . By regulating the expression of these dominant-negative variants, researchers can modulate selection stringency.

  • Structural modifications: With the newly available structural information about the pointy tip of the phage, researchers can design rational modifications to the G3P structure to alter infection efficiency or host range specificity . These modifications can be used to adapt PACE systems for different bacterial hosts or to enhance the evolvability of the system.

  • Fusion protein engineering: By leveraging knowledge about permissible fusion sites in G3P, researchers can develop PACE systems with novel functionalities, such as targeting specific bacterial receptors or incorporating additional selection mechanisms based on protein-protein interactions .

These approaches allow researchers to fine-tune PACE systems for diverse applications, from evolving enzymes with novel activities to developing protein-based therapeutics with enhanced properties.

What are the common challenges in structural studies of G3P, and how can they be addressed?

Structural studies of G3P present several challenges due to the protein's complex domain organization and flexibility. Here are common challenges and strategies to address them:

  • Domain flexibility: The flexible glycine-rich linker between N1 and N2 domains can complicate structural determination. To address this:

    • Use fusion proteins with rigid linkers for crystallization studies

    • Apply domain-specific crystallization approaches

    • Employ cryo-electron microscopy to capture different conformational states

  • Dynamic interactions: The transient nature of G3P interactions with receptors makes capturing these complexes difficult.

    • Create fusion proteins that stabilize the interaction, as demonstrated in the G3P N1-TolA D3 complex study

    • Use crosslinking approaches to stabilize transient complexes

    • Apply hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Integration into phage particles: Studying G3P in its native environment within phage particles presents technical difficulties.

    • Use nanorods generated through two-plasmid systems for controlled production of short phage-like particles

    • Apply advanced image processing techniques to distinguish domains in cryo-EM studies

    • Combine structural approaches with functional assays to correlate structure with biological activity

These strategies have enabled recent breakthroughs in understanding G3P structure, including the visualization of the filamentous phage structure with both cap regions through cryo-electron microscopy .

How can researchers reconcile conflicting data regarding G3P domain interactions and conformational changes?

Reconciling conflicting data regarding G3P domain interactions and conformational changes requires a systematic approach that integrates multiple experimental techniques and considers the dynamic nature of the protein. Researchers should:

  • Consider experimental conditions: Different buffer conditions, pH values, and ionic strengths can significantly affect G3P conformations and interactions. Standardizing these conditions or systematically exploring their effects can help resolve apparent contradictions.

  • Examine temporal aspects: G3P undergoes sequential conformational changes during the phage infection process. Differences in observed structures or interactions may reflect different stages of this process rather than contradictory results.

  • Integrate multiple structural techniques: Combining X-ray crystallography (which provides atomic-level static structures) with cryo-EM (which can capture conformational ensembles) and solution-based techniques like SAXS or NMR can provide a more complete picture of G3P dynamics .

  • Apply molecular dynamics simulations: Computational approaches can bridge gaps between experimental observations by modeling transitions between different conformational states and predicting the effects of mutations or environmental changes.

  • Develop testable models: When faced with conflicting data, researchers should develop models that make specific, testable predictions and then design experiments to validate or refute these models. For example, the model proposing displacement of G3P N2 by TolA D3 was confirmed through structural studies of the G3P N1-TolA D3 complex .

By systematically applying these approaches, researchers can develop unified models that accommodate seemingly contradictory observations and advance our understanding of G3P function.

What criteria should be used to evaluate the success of G3P engineering for altered functionality?

Evaluating the success of G3P engineering for altered functionality requires comprehensive assessment across multiple parameters:

Assessment CriterionMeasurement MethodSuccess Indicators
Structural IntegrityCircular dichroism, thermal stability assaysPreserved secondary structure, thermal stability comparable to wild-type
Expression EfficiencySDS-PAGE, Western blotYield comparable to wild-type, minimal degradation products
Phage AssemblyElectron microscopy, phage titer assaysNormal morphology, comparable particle counts
Host RangePlaque assays on diverse bacterial strainsInfection of target hosts, specificity as designed
Infection EfficiencyOne-step growth curves, adsorption assaysEfficient adsorption to target cells, normal latent period
Therapeutic Efficacy (if applicable)In vitro bacterial killing, in vivo infection modelsReduction in bacterial counts, improved survival in animal models, minimal endotoxin release
Display Functionality (if applicable)Binding assays, phage ELISAAccessibility of displayed peptides/proteins, retained binding functionality

Each engineering objective requires specific evaluation criteria. For example, when engineering non-lytic therapeutic variants, researchers should assess: (1) bacterial killing efficiency, (2) absence of lytic activity, (3) minimal endotoxin release, and (4) therapeutic efficacy in relevant models . For phage display applications, successful engineering should maintain display capacity while preserving infection capability sufficient for phage propagation .

Ultimately, the engineered G3P should fulfill its intended function while maintaining sufficient structural and functional integrity to support the phage life cycle unless deliberately designed otherwise.

What are the emerging approaches for studying G3P dynamics during phage infection?

Emerging approaches for studying G3P dynamics during phage infection combine cutting-edge structural biology techniques with advanced biophysical methods:

  • Time-resolved cryo-electron microscopy: This approach captures structural snapshots of the infection process at different time points, revealing dynamic conformational changes in G3P during receptor binding and membrane penetration .

  • Single-molecule FRET: By labeling specific domains of G3P with fluorophore pairs, researchers can observe real-time conformational changes during infection at the single-molecule level, providing insights into the heterogeneity and kinetics of these processes.

  • In situ structural biology: Techniques such as cryo-electron tomography combined with subtomogram averaging allow visualization of phage-host interactions in their native cellular environment, revealing the spatial organization of G3P domains during infection.

  • Integrative structural modeling: Combining data from multiple experimental sources (X-ray crystallography, cryo-EM, crosslinking mass spectrometry, SAXS) with computational modeling provides comprehensive models of G3P dynamics that reconcile observations from different techniques.

  • AlphaFold and related AI approaches: These methods are increasingly being used to predict G3P structures and conformational changes, as demonstrated in recent studies where AlphaFold was used to predict the structure of linkers and N1-N2 domains based on available X-ray structures .

These emerging approaches promise to provide unprecedented insights into the dynamic processes underlying phage infection, enabling more effective engineering of G3P for biotechnological applications.

How might our understanding of G3P structure-function relationships inform the development of novel antimicrobial strategies?

Our deepening understanding of G3P structure-function relationships opens several avenues for developing novel antimicrobial strategies:

  • Engineered non-lytic phages: Building on successful examples like the Pf3R variant, researchers can design phages that deliver bactericidal payloads without triggering massive endotoxin release, potentially overcoming a major limitation of conventional phage therapy .

  • Receptor decoys: Detailed knowledge of how G3P interacts with bacterial receptors enables the design of soluble decoy molecules that could prevent phage infection or, conversely, synthetic mimics of G3P domains that could block bacterial pathogenesis by binding to essential membrane proteins like TolA.

  • Targeted drug delivery: G3P domains could be repurposed as targeting moieties for drug delivery systems, directing antimicrobial agents specifically to bacteria expressing F pili or other receptors.

  • Phage-antibiotic synergy: Understanding the molecular details of phage-host interactions could reveal vulnerabilities in bacterial defenses that could be exploited by combination therapies involving phages and conventional antibiotics.

  • Evolutionary considerations: The structure-function insights from G3P research inform our understanding of phage-host coevolution, potentially allowing us to predict and counter bacterial resistance mechanisms against phage therapy.

These approaches represent promising directions for addressing the growing crisis of antibiotic resistance through targeted, biology-based interventions that exploit the specificity and adaptability of phage-host interactions.

What computational approaches show promise for predicting the effects of G3P modifications on phage functionality?

Several computational approaches show significant promise for predicting the effects of G3P modifications on phage functionality:

  • Machine learning models: By training on existing data about G3P mutations and their phenotypic effects, machine learning algorithms can predict the impact of novel modifications on phage infectivity, host range, and stability.

  • Molecular dynamics simulations: Extended simulations of G3P domains and their interactions with receptors can predict how specific mutations affect binding energetics and conformational dynamics, providing insights into the functional consequences of structural modifications .

  • AI structure prediction: Tools like AlphaFold have already been successfully applied to predict G3P structures based on existing data . These approaches can be extended to model the effects of mutations on protein folding and stability, informing rational design strategies.

  • Network analysis of protein-protein interactions: Computational analyses of the interaction networks involving G3P and host proteins can identify critical nodes and predict how modifications might alter these networks, affecting phage functionality.

  • Evolutionary sequence analysis: Comparative analysis of G3P sequences across different phages, combined with information about their host ranges, can identify conserved and variable regions that tolerate modifications, guiding engineering efforts.

These computational approaches, especially when integrated with experimental validation, enable more efficient design-build-test cycles for G3P engineering, accelerating the development of phages with novel functionalities for research and therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.