Recombinant Enterobacteria phage f1 Head virion protein G6P (VI)

Shipped with Ice Packs
In Stock

Description

Functional Role in Phage Biology

G6P (VI) plays dual roles in phage f1:

  • Virion Assembly: Forms a complex with G3P (adsorption complex) to terminate phage assembly and integrate into the virion structure .

  • Host Interaction: Localizes at the phage tip to mediate bacterial host membrane interactions during infection . Cryo-EM studies reveal its interaction with G3P and G8P at the virion’s pointy tip, critical for DNA ejection and progeny release .

Production and Purification

Recombinant G6P is typically expressed in E. coli with affinity tags (e.g., His-tag) for purification . Key protocols include:

  • Expression: Optimized in Tris/PBS-based buffers with glycerol for stability .

  • Reconstitution: Lyophilized protein is reconstituted in sterile water (0.1–1.0 mg/mL) and stored with 50% glycerol at -80°C .

Research Applications

This protein is pivotal in:

  • Structural Studies: Cryo-EM analyses (e.g., PDB ID: 8B3O) resolved its role in phage tip architecture .

  • Phage-Host Dynamics: Mutagenesis studies link G6P domains to bacterial membrane penetration and progeny release .

  • Biotechnology: Serves as a model for engineered viral vectors and nanoscale delivery systems .

Key Research Findings

Recent advances include:

StudyMethodKey Insight
Cryo-EM of phage f1 tip (2023) Cryo-electron microscopyIdentified G6P-G3P-G8P interactions critical for infection and assembly.
DNA Packaging Mechanisms Biochemical assaysDemonstrated G6P’s role in stabilizing spooled DNA within the capsid.

Challenges and Future Directions

While recombinant G6P has advanced phage research, limitations include:

  • Tag Interference: N-/C-terminal tags may alter native protein interactions .

  • Storage Stability: Lyophilized forms require stringent temperature control .
    Future work aims to engineer tag-free variants and optimize production for therapeutic applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
VI; Head virion protein G6P; Coat protein D; G6P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Enterobacteria phage f1 (Bacteriophage f1)
Target Names
VI
Target Protein Sequence
MPVLLGIPLLLRFLGFLLVTLFGYLLTFLKKGFGKIAIAISLFLALIIGLNSILVGYLSD ISAQLPSDFVQGVQLILPSNALPCFYVILSVKAAIFIFDVKQKIVSYLDWDK
Uniprot No.

Target Background

Function
This protein plays crucial roles in both the entry of the viral genome into the bacterial host and the budding process. The formation of the G3P-G6P complex, termed the adsorption complex, is essential for the proper termination of filamentous phage assembly.
Protein Families
Inovirus G6P protein family
Subcellular Location
Virion. Host membrane; Multi-pass membrane protein.

Q&A

What is the primary function of G6P (pVI) in Enterobacteria phage f1?

G6P (pVI) is a minor virion protein that plays essential roles in the release of virions from the host membrane. It forms part of the virion cap structure in conjunction with pIII (G3P). The formation of the G3P-G6P complex is critical for correct termination of filamentous phage assembly and formation of the pIII-pVI virion cap . This protein-protein interaction represents a crucial structural element that maintains the integrity of the phage particle during the infection cycle and subsequent release.

How does G6P compare structurally to homologous proteins in other bacteriophages?

G6P from Enterobacteria phage f1 (accession P69531) shares significant homology with minor virion proteins from other filamentous phages. It has direct homologs in Enterobacteria phage Ike (P03674), Pseudomonas phage Pf1 (Q38066), Pseudomonas phage Pf3 (P03625), and Pseudomonas Pf4 (Q9I5K3) . Interestingly, it also shows homology to the Ace protein from Vibrio cholerae phage CTX (Q7BBA3) and ORF10 from Ralstonia phage Rsm1 (A0JC05) . These structural similarities suggest evolutionary conservation of this protein's function across diverse bacteriophage species, despite adaptation to different bacterial hosts.

What protein interactions are crucial for G6P function in the phage life cycle?

G6P forms critical interactions with pIII (G3P) to create the virion cap structure. This G3P-G6P complex is essential for proper phage assembly termination . Additionally, G6P likely interacts with other structural proteins like pVIII (the major coat protein) which forms the helical filament-like capsid wrapping the viral genomic DNA . These protein-protein interactions establish the structural framework necessary for virion stability and successful host infection.

Which expression systems are most effective for producing recombinant G6P?

For recombinant production of G6P, E. coli-based expression systems are most commonly employed due to the protein's natural occurrence in Enterobacteria phages. When expressing G6P, researchers must consider its membrane-associated properties. Expression vectors containing T7 or similar strong promoters with appropriate fusion tags (His6, GST, or MBP) can enhance solubility and facilitate purification. The BL21(DE3) E. coli strain is particularly suitable given its reduced protease activity. For structural studies requiring high purity, specialized expression systems like IMPACT (Intein Mediated Purification with an Affinity Chitin-binding Tag) may be preferred to avoid tag interference with protein function.

What purification challenges are commonly encountered with recombinant G6P?

Purification of recombinant G6P presents several challenges due to its membrane-associated nature. Researchers frequently encounter issues with protein aggregation, insolubility, and non-specific binding during purification. Optimized solubilization protocols using mild detergents like n-dodecyl-β-D-maltoside (DDM) or 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate (CHAPS) are recommended for extracting the protein while maintaining its native conformation. Sequential chromatography approaches combining affinity chromatography, ion exchange, and size exclusion steps yield the highest purity. Protein stability during concentration steps can be enhanced by including glycerol (10-15%) in the buffer system.

How can researchers verify the structural integrity of purified recombinant G6P?

Verification of recombinant G6P structural integrity requires multiple analytical approaches. Circular dichroism (CD) spectroscopy provides assessment of secondary structure elements, while thermal shift assays can evaluate protein stability. Functionality can be confirmed through binding assays with recombinant G3P (pIII) partner protein, as the G3P-G6P interaction is critical for phage assembly termination . Mass spectrometry analysis, particularly ESI-MS/MS similar to that used for CBB phage structural proteins, can confirm protein identity and potential post-translational modifications . For highest resolution structural confirmation, X-ray crystallography or cryo-electron microscopy can determine if the recombinant protein adopts its native conformation.

How is recombinant G6P utilized in studying phage-host interactions?

Recombinant G6P serves as a valuable tool for investigating phage-host interactions at the molecular level. Researchers employ fluorescently labeled G6P to track virion assembly and release processes in real-time microscopy studies. Pull-down assays using tagged G6P can identify host factors that interact with this protein during infection. Mutation studies of G6P followed by phage assembly assays help delineate the specific amino acid residues essential for virion formation and release from the host membrane. The protein can also serve as an antigen for generating antibodies to study phage localization during the infection cycle through immunofluorescence microscopy.

What techniques are used to study G6P-G3P complex formation?

The critical G6P-G3P (pVI-pIII) complex formation can be studied using several biophysical and biochemical techniques. Surface plasmon resonance (SPR) provides quantitative binding kinetics (ka, kd) and affinity constants (KD) for the interaction. Isothermal titration calorimetry (ITC) measures the thermodynamic parameters of complex formation. For structural studies, nuclear magnetic resonance (NMR) spectroscopy or X-ray crystallography of the co-crystallized proteins provides atomic-level details of the interaction interface. Co-immunoprecipitation assays with antibodies against either protein can verify complex formation in solution, while fluorescence resonance energy transfer (FRET) using fluorescently labeled proteins can monitor complex dynamics in real-time.

How does G6P compare to other structural proteins in filamentous phages?

G6P (pVI) functions as a minor virion protein specifically involved in virion capping and release, distinguishing it from major structural proteins like pVIII (G8P) that forms the bulk of the filamentous capsid . Unlike pIII (G3P), which mediates phage adsorption to bacterial F-pili and TolA receptors, G6P does not directly participate in host recognition . The table below summarizes key comparisons between G6P and other structural proteins in filamentous phages:

ProteinPrimary FunctionLocation in VirionKey InteractionsHomology Across Phages
pVI (G6P)Virion release; cap formationVirion cappIII (G3P)Moderate conservation across filamentous phages
pIII (G3P)Host receptor binding; infectionVirion cappVI, pVIII, host TolAHigh conservation in F-pilus-specific phages
pVIII (G8P)Major capsid proteinHelical filament bodyDNA, neighboring pVIII unitsVariable conservation (8-35% identity)
pVII (G7P)Initiation of assemblyVirion initiation endpIX, packaging signalLimited homology data available
pIX (G9P)Initiation of assemblyVirion initiation endpVII, packaging signalLimited homology data available

How do conformational changes in G6P impact phage assembly dynamics?

Conformational changes in G6P play a pivotal role in phage assembly and release processes. Recent structural studies suggest G6P undergoes significant conformational rearrangements during different stages of the phage life cycle, similar to the conformational gymnastics observed in ejection proteins of T7-like phages . These structural transitions likely facilitate the formation of the G3P-G6P cap complex and subsequent virion release from the host membrane. Advanced techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map these conformational dynamics by identifying regions of differential solvent accessibility. Single-molecule FRET studies with strategically placed fluorophores can track distance changes between protein domains during the assembly process, providing insights into the mechanical aspects of G6P function.

What are the current challenges in resolving the complete structure of G6P in different functional states?

Resolving the complete structure of G6P presents significant challenges due to its conformational flexibility and membrane association. Like ejection proteins in other phages, G6P likely adopts different conformations during the assembly process . Current structural determination difficulties include: 1) Obtaining sufficient quantities of properly folded protein, 2) Crystallization challenges due to inherent flexibility, 3) Detergent micelle interference in structural studies, and 4) Capturing transient functional states. Researchers are addressing these challenges through advanced approaches including nanodiscs to mimic membrane environments, cryo-electron tomography to visualize G6P in situ, and computational molecular dynamics simulations to model conformational transitions. Cross-linking mass spectrometry (XL-MS) is also being employed to identify distance constraints between interacting regions.

How does G6P contribute to phage genome packaging and DNA protection?

While G6P is primarily known for its role in virion structure and release, emerging evidence suggests potential contributions to genome packaging and DNA protection. During phage assembly, G6P may interact with the packaged ssDNA either directly or through its association with other structural proteins. This interaction could provide protection against host nucleases similar to how pV (G5P) binds to ssDNA to prevent conversion to the double-stranded replicative form . The precise mechanism remains under investigation, but chromatin immunoprecipitation sequencing (ChIP-seq) with antibodies against G6P could identify potential DNA binding sites. In vitro DNA protection assays comparing nuclease sensitivity of DNA in the presence and absence of purified G6P would further elucidate this protective function.

How can researchers overcome aggregation issues when working with recombinant G6P?

Protein aggregation represents a significant challenge when working with recombinant G6P. To overcome this issue, researchers should implement several optimized strategies: 1) Express the protein at lower temperatures (16-18°C) to slow folding and prevent inclusion body formation, 2) Include solubility-enhancing fusion partners such as MBP or SUMO, 3) Optimize buffer conditions with stabilizing agents like arginine (50-100 mM) and low concentrations of non-ionic detergents, 4) Utilize on-column refolding protocols during purification to gradually remove denaturants, and 5) Apply high-resolution size exclusion chromatography as a final purification step to separate monomeric from aggregated species. Additionally, adding glycerol (5-10%) and maintaining protein at moderate concentrations (<1 mg/ml) can prevent aggregation during storage.

What strategies can improve the yield of functional G6P-G3P complex formation in vitro?

Optimizing functional G6P-G3P complex formation requires careful attention to protein stoichiometry, buffer conditions, and reaction kinetics. Researchers should consider: 1) Purifying both proteins separately using similar buffer systems to ensure compatibility, 2) Performing systematic titration experiments to determine optimal protein ratios (typically slight excess of one partner improves complex yield), 3) Including stabilizing agents like glycerol (10%) and non-ionic detergents below their critical micelle concentration, 4) Controlling the rate of complex formation through gradual dialysis or on-column association methods, and 5) Verifying complex formation using analytical size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm proper stoichiometry. Native mass spectrometry can provide additional confirmation of intact complex formation with precise mass measurements.

How can researchers differentiate between functional and non-functional recombinant G6P in their preparations?

Distinguishing functional from non-functional recombinant G6P requires multi-faceted analytical approaches. Researchers should implement: 1) Binding assays with recombinant G3P, as only properly folded G6P will form the critical G3P-G6P complex essential for phage assembly , 2) Limited proteolysis fingerprinting, where properly folded protein shows distinct digestion patterns compared to misfolded variants, 3) Thermal shift assays to measure protein stability, with functional protein typically showing cooperative unfolding transitions, 4) Complementation assays using G6P-deficient phage systems, where only functional protein restores virion production, and 5) Negative-stain electron microscopy to visualize protein morphology, with functional protein showing homogeneous distributions versus the heterogeneous appearance of non-functional aggregates. These combined approaches provide comprehensive assessment of recombinant G6P functionality.

How might structural studies of G6P inform the development of novel antimicrobial strategies?

Detailed structural characterization of G6P could reveal critical interfaces essential for phage assembly that might serve as targets for novel antimicrobials. Since G6P plays a vital role in virion release from the host membrane , compounds disrupting its function could potentially inhibit phage propagation in bacteria carrying resistance genes. Structural studies identifying the precise interaction interface between G6P and G3P could guide structure-based drug design for molecules that specifically disrupt this complex. Additionally, understanding the conformational changes G6P undergoes during phage assembly might reveal transient states susceptible to targeting by small molecules. These approaches could lead to new anti-phage strategies relevant for preventing horizontal gene transfer of antibiotic resistance genes or for controlling phage-mediated bacterial pathogenesis as seen with the CTXφ phage in Vibrio cholerae .

What potential applications exist for engineered G6P variants in biotechnology?

Engineered G6P variants offer promising applications in biotechnology based on their structural properties and interactions. Potential applications include: 1) Developing novel protein display systems by fusing target proteins to modified G6P for incorporation into phage particles, 2) Creating responsive nanomaterials that assemble or disassemble based on G6P conformational changes triggered by environmental stimuli, 3) Engineering biosensors using G6P-G3P interactions tagged with reporter molecules to detect specific biological targets, 4) Developing targeted drug delivery systems using modified filamentous phage particles with engineered G6P variants capable of recognizing specific cell types, and 5) Creating scaffolds for enzyme immobilization and nanoscale organization by exploiting G6P's role in phage structural organization. These applications leverage the natural properties of G6P while extending its functionality through protein engineering approaches.

How does post-translational modification affect G6P function in different host systems?

Post-translational modifications (PTMs) of G6P represent an understudied aspect that may significantly impact its function across different host systems. While the natural Enterobacteria phage f1 G6P may undergo specific modifications in its native host, recombinant expression in different systems could result in altered modification patterns. Research questions include whether G6P undergoes phosphorylation, acetylation, or other modifications that might regulate its interaction with G3P or membrane association. Mass spectrometry approaches like those used to identify structural proteins in CBB phage can map PTM profiles. Comparative studies expressing G6P in different host systems (E. coli, Pseudomonas, yeast) followed by functional assays would reveal how host-specific modifications impact protein function. These insights could explain functional variations observed when studying this protein in heterologous systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.