Recombinant Enterobacteria phage f1 Virion export protein (IV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To ensure a specific tag, please inform us during your order; we will prioritize development accordingly.
Synonyms
IV; Virion export protein; Gene 4 protein; G4P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-426
Protein Length
Full Length of Mature Protein
Species
Enterobacteria phage f1 (Bacteriophage f1)
Target Names
IV
Target Protein Sequence
QVIEMNNSSLRDFVTWYSKQTGESVIVSPDVKGTVTVYSSDVKPENLRDFFISVLRANNF DMVGSIPSIIQKYNPNNQDYIDELPSSDNQEYDDNSAPSGGFFVPQNDNVTQTFKINNVR AKDLIRVVELFVKSNTSKSSNVLSVDGSNLLVVSAPKDILDNLPQFLSTVDLPTDQILIE GLIFEVQQGDALDFSFAAGSQRGTVAGGVNTDRLTSVLSSAGGSFGIFNGDVLGLSVRAL KTNSHSKILSVPRILTLSGQKGSISVGQNVPFITGRVTGESANVNNPFQTVERQNVGISM SVFPVAMAGGNIVLDITSKADSLSSSTQASDVITNQRSIATTVNLRDGQTLLLGGLTDYK NTSQDSGVPFLSKIPLIGLLFSSRSDSNEESTLYVLVKATIVRAL
Uniprot No.

Target Background

Function

This protein functions in bacteriophage assembly and extrusion by creating a channel across the host outer membrane. This channel facilitates the passage of newly synthesized phage particles. Extrusion, a simultaneous assembly and secretion process, occurs at specific sites where the host's inner and outer membranes are in close proximity.

Protein Families
Inovirus G4P protein family
Subcellular Location
Host membrane; Single-pass type I membrane protein.

Q&A

How does pIV interact with other phage proteins during assembly?

The pIV protein operates as part of an intricate trans-envelope assembly and secretion system for filamentous phages. Key interactions include:

  • Interaction with pI (G1P): pIV directly interacts with pI, which serves as the inner membrane component of the trans-envelope assembly/secretion system . This interaction is crucial for creating a continuous channel from the inner to the outer membrane.

  • Assembly pathway coordination: pIV functions in concert with other phage proteins to facilitate the ordered assembly of phage particles. In particular:

    • pI and pXI form a complex at the inner membrane

    • pIV forms the outer membrane channel

    • pVII and pIX interact with the packaging signal of the viral genome to initiate assembly

    • pVIII (major capsid protein) is gradually incorporated during the assembly process

  • Protection of assembly components: pIV forms part of a trans-membrane complex with pI and pXI that protects pI from cleavage by endogenous bacterial proteases .

The interaction network can be visualized in the following functional relationship table:

ProteinPrimary FunctionInteraction with pIVConsequence of Interaction
pI (G1P)Inner membrane componentDirect bindingForms continuous secretion channel
pXIProtects pI from proteasesIndirect (via pI)Stabilizes assembly complex
pVII/pIXInitiate virion assemblyNo direct interactionDownstream assembly components
pVIIIMajor capsid proteinPasses through pIV channelPhage export

What are the key differences between Enterobacteria phage f1 and IKe Virion export proteins?

Although Enterobacteria phage f1 and IKe Virion export proteins (pIV) serve similar functions, they exhibit notable differences in sequence and specific properties:

  • Sequence similarity: Alignment analyses show that while both proteins are functionally homologous, they differ significantly in their primary sequences. Enterobacteria phage IKe pIV (UniProt ID: P03667) is a related but distinct protein .

  • Length variations: The f1 pIV mature protein spans residues 22-426 (405 amino acids), while IKe pIV spans residues 31-437 (407 amino acids) .

  • Amino acid composition: Comparative sequence analysis reveals distinct differences, particularly in regions involved in host-specificity and channel properties.

  • Host range implications: These sequence differences likely contribute to potential variations in host range restrictions between the phages, as the export apparatus must interact properly with host membrane systems.

  • Conservation of function: Despite these differences, both proteins form outer membrane channels that function in phage export, highlighting the evolutionary conservation of this critical function across related phages .

The sequence identity between these two proteins is sufficient to classify them as homologs, but their differences reflect the evolutionary divergence between these related phage species.

How can mutational analysis of pIV inform its gating mechanism and assembly pathway?

Mutational analysis of pIV provides critical insights into both its gating mechanism and role in the phage assembly pathway. A comprehensive approach involves:

  • Systematic mutagenesis strategies:

    • Alanine scanning mutagenesis across the entire sequence to identify functionally important residues

    • Targeted mutagenesis of conserved domains based on sequence alignments with homologs like IKe pIV

    • Domain swapping between f1 and other phage pIV proteins to identify specificity determinants

  • Functional assessments of mutations:

    • Phage production efficiency measurements using plaque assays

    • Electron microscopy to visualize assembly intermediates

    • Protein secretion assays to measure channel functionality

  • Gating mechanism insights:
    Mutations in specific regions of pIV can reveal how the channel transitions between closed and open states. Key areas for investigation include:

    • N-terminal domains involved in sensing assembled phage particles

    • Central channel-forming regions that control pore diameter

    • C-terminal regions potentially involved in multimerization and anchoring

  • Assembly pathway elucidation:
    By generating conditional mutants (temperature-sensitive, for example), researchers can trap assembly intermediates that reveal the sequential steps of phage morphogenesis involving pIV:

    • Early stage: pIV multimerization and membrane insertion

    • Middle stage: interaction with inner membrane components (pI/pXI)

    • Late stage: phage particle transit through the channel

  • Structure-function relationships:
    Correlating mutational data with structural models can provide mechanistic understanding of how conformational changes in pIV facilitate phage export .

What are the experimental approaches to study pIV-mediated phage resistance mechanisms?

Investigating pIV-mediated phage resistance mechanisms requires multifaceted experimental approaches:

  • Competitive infection assays:

    • Co-culture bacteria expressing wild-type versus mutant pIV proteins

    • Quantify relative phage susceptibility through plaque assays

    • Measure kinetics of phage production in mixed populations

  • Receptor competition studies:

    • Test whether soluble pIV fragments can inhibit phage infection

    • Perform binding assays with labeled phage particles and purified pIV variants

    • Quantify binding affinities between phage components and pIV

  • Cross-resistance profiling:

    • Generate panel of bacteria expressing pIV variants

    • Challenge with diverse phage isolates to map resistance patterns

    • Correlate resistance profiles with pIV sequence variations

  • Phage evolution experiments:

    • Serial passage phages on bacteria expressing restrictive pIV variants

    • Sequence evolved phages to identify adaptations overcoming restriction

    • Test for mutations in phage proteins that interact with pIV

  • Phage protein inhibitor studies:
    Recent research on type IV restriction inhibiting factors (TIFs) has revealed mechanisms by which phages can overcome bacterial defense systems. Similar mechanisms may apply to pIV-mediated resistance, where phage proteins might evolve to neutralize or bypass pIV restrictions .

  • Structural biology approaches:

    • Cryo-EM structures of pIV in complex with phage components

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Molecular dynamics simulations to predict resistance mechanisms

These approaches collectively can reveal how pIV functions in phage resistance and how phages may evolve counter-strategies.

What are the molecular mechanisms controlling pIV oligomerization and channel formation?

The oligomerization of pIV to form functional channels is a complex process involving multiple molecular mechanisms:

  • Determinants of oligomerization:

    • C-terminal domains contain oligomerization motifs that drive multimerization

    • Conserved hydrophobic patches likely form the interfaces between monomers

    • Disulfide bond formation may stabilize the multimeric structure under certain conditions

  • Channel assembly pathway:

    • Initial monomer insertion into the outer membrane

    • Nucleation of dimers or small oligomers

    • Cooperative assembly into complete multimeric channels (typically 12-14 subunits)

    • Conformational maturation to form the functional gated pore

  • Regulatory mechanisms:

    • Interaction with inner membrane proteins (pI/pXI) may trigger conformational changes

    • Environmental signals (pH, membrane potential) potentially modulate assembly

    • Host factors that might facilitate or inhibit oligomerization

  • Structural transitions during gating:

    • Resting (closed) state maintains membrane integrity

    • Triggering mechanisms that detect approaching phage particles

    • Conformational switch to open state allowing phage transit

    • Return to closed state after phage export

  • Experimental approaches to study oligomerization:

    • Blue native PAGE to analyze oligomeric states

    • Single-particle cryo-EM to determine structure of the channel

    • Fluorescence resonance energy transfer (FRET) to monitor assembly dynamics

    • Cross-linking studies to capture assembly intermediates

  • Computational modeling:

    • Molecular dynamics simulations to predict oligomerization interfaces

    • Coarse-grained models to simulate assembly pathways

    • Quantum mechanics/molecular mechanics approaches to model gating transitions

Understanding these mechanisms has implications beyond phage biology, as pIV belongs to the secretin family of proteins that are widely distributed in bacterial secretion systems .

What are the optimal conditions for expressing and purifying recombinant pIV protein?

Optimizing expression and purification of recombinant pIV requires careful consideration of several parameters:

  • Expression system selection:

    • E. coli is the preferred host for recombinant production, with BL21(DE3) or similar strains showing good expression levels

    • Expression vectors should include:

      • Strong inducible promoter (T7 or arabinose-inducible systems)

      • N-terminal His-tag for purification

      • Signal sequence if membrane localization is desired

  • Induction parameters:

    • Temperature: Lower temperatures (16-18°C) often improve proper folding

    • Inducer concentration: Typically 0.1-0.5 mM IPTG for T7 systems

    • Induction time: Extended periods (overnight) at lower temperatures

    • Cell density: Induce at OD600 of 0.6-0.8 for optimal balance of growth and expression

  • Extraction and solubilization:

    • Cell lysis by sonication or high-pressure homogenization

    • Membrane extraction using detergents such as:

      • n-Dodecyl β-D-maltoside (DDM): 1-2% for initial extraction

      • Lauryldimethylamine oxide (LDAO): 0.5-1% for solubilization

      • Octyl glucoside (OG): 0.5-1% for milder extraction

  • Purification strategy:

    • Initial capture: Ni-NTA affinity chromatography

      • Binding buffer: 20 mM Tris pH 8.0, 300 mM NaCl, 20 mM imidazole, 0.05% detergent

      • Wash buffer: Same as binding but with 50 mM imidazole

      • Elution buffer: Same as binding but with 250-500 mM imidazole

    • Secondary purification: Size exclusion chromatography

      • Typical buffer: 20 mM Tris pH 7.5, 150 mM NaCl, 0.05% detergent

  • Storage conditions:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Aliquot and store at -20°C/-80°C

    • Add 5-50% glycerol as a cryoprotectant for long-term storage

    • Avoid repeated freeze-thaw cycles

  • Quality control assessments:

    • SDS-PAGE for purity (>90% is typical for research applications)

    • Western blotting for identity confirmation

    • Circular dichroism to verify secondary structure

    • Dynamic light scattering to assess oligomeric state and aggregation

Following these guidelines should yield recombinant pIV protein suitable for structural and functional studies.

How can researchers assess the functionality of purified recombinant pIV in vitro?

Assessing functionality of purified recombinant pIV requires multiple complementary approaches:

  • Membrane insertion and channel formation assays:

    • Liposome incorporation: Reconstitute purified pIV into liposomes and verify insertion by flotation assays

    • Black lipid membrane electrophysiology: Measure single-channel conductance and gating properties

    • Fluorescent dye release assays: Encapsulate fluorescent dyes in liposomes and measure release upon pIV incorporation

  • Structural integrity assessment:

    • Negative-stain electron microscopy: Visualize pIV multimers and assess their structural uniformity

    • Size exclusion chromatography: Verify oligomeric state of the purified protein

    • Analytical ultracentrifugation: Determine sedimentation coefficient and molecular weight of assemblies

  • Functional protein-protein interaction assays:

    • Pull-down assays with other phage proteins, particularly pI (G1P)

    • Surface plasmon resonance (SPR) to measure binding kinetics with interacting partners

    • Microscale thermophoresis to quantify interactions in near-native conditions

  • Channel activity verification:

    • Proteoliposome swelling assays: Measure osmotic swelling rates as indicator of pore formation

    • Ion flux measurements: Use ion-selective electrodes to measure permeability

    • Fluorescence quenching assays: Monitor accessibility of membrane-impermeable quenchers

  • Functional complementation:

    • In vitro phage assembly systems reconstituted with purified components

    • Membrane vesicle-based assembly assays incorporating recombinant pIV

  • Structural dynamics:

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Single-molecule FRET to monitor conformational changes during gating

When developing these assays, researchers should consider both positive and negative controls:

  • Positive control: Wild-type pIV with confirmed activity

  • Negative controls: Heat-denatured pIV or mutants known to disrupt function

What are the critical considerations for designing experiments to study pIV-mediated phage export?

Designing robust experiments to study pIV-mediated phage export requires careful consideration of several factors:

  • Genetic system design:

    • Construct complementation systems with:

      • pIV deletion background strains

      • Inducible expression vectors for wild-type and mutant pIV

      • Reporter systems to quantify phage production

    • Consider using amber suppressors for conditional expression

  • Phage export quantification methods:

    • Phage titering: Standard plaque assays on permissive hosts

    • qPCR-based quantification: Measure extracellular vs. intracellular phage genome copies

    • Western blotting: Detect major coat protein in cellular and extracellular fractions

    • Electron microscopy: Visualize assembled phage particles inside and outside cells

  • Time-course considerations:

    • Synchronize infection using high multiplicity of infection

    • Sample at regular intervals (e.g., every 5-10 minutes) post-infection

    • Monitor both phage export and cellular physiology parameters

  • Controls and variables:

    • Positive controls: Wild-type pIV expression

    • Negative controls:

      • pIV deletion strains

      • Dominant-negative pIV mutants

      • Conditions blocking assembly (energy depletion)

    • Variables to manipulate:

      • pIV expression levels

      • Temperature

      • Membrane composition (via growth conditions)

  • Advanced imaging approaches:

    • Correlative light and electron microscopy (CLEM) to visualize phage export in real-time

    • Cryo-electron tomography of infected cells to capture export intermediates

    • Super-resolution fluorescence microscopy with labeled phage components

  • Biochemical isolation of export intermediates:

    • Cell fractionation to isolate membrane components

    • Immunoprecipitation of pIV complexes at different stages

    • Cross-linking to capture transient interaction states

  • Data analysis and interpretation:

    • Kinetic modeling of export rates

    • Correlation of structural features with export efficiency

    • Statistical approaches to account for cell-to-cell variability

These considerations will help ensure that experiments provide meaningful insights into the mechanism of pIV-mediated phage export.

How can Enterobacteria phage f1 pIV be engineered for gene delivery applications?

Engineering pIV for gene delivery applications leverages its natural function in phage export to create novel delivery systems:

  • Rational design modifications for gene delivery:

    • Channel diameter engineering: Mutations to expand the pore size for larger cargo

    • Gating mechanism modifications: Engineering constitutively open or stimulus-responsive channels

    • Fusion with targeting domains: Addition of cell-type specific ligands for targeted delivery

    • Surface charge modifications: Altering electrostatic properties to enhance cellular uptake

  • Integration with phage-based delivery systems:
    Similar to the T4 phage delivery system described in , pIV can be incorporated into comprehensive delivery platforms:

    • Use pIV as part of reconstituted phage-like particles

    • Engineer hybrid systems combining pIV channels with synthetic nanoparticles

    • Create chimeric delivery vehicles with components from different phage systems

  • Expression system considerations:

    • Development of inducible expression systems in recipient cells

    • Design of self-assembling pIV nanostructures for ex vivo loading and delivery

    • Optimization of secretory pathways for efficient channel assembly

  • Cargo compatibility engineering:

    • Modifications to accommodate various nucleic acid forms (plasmids, linear DNA, RNA)

    • Adaptations for protein/peptide delivery

    • Development of molecular adapters for non-natural cargo

  • Advantages of pIV-based delivery systems:

    • Natural membrane insertion capabilities

    • Potential for high-efficiency delivery

    • Ability to engineer specificity and responsiveness

    • Integration with other phage components for multifunctional delivery

  • Experimental validation approaches:

    • In vitro testing: Liposome-based delivery assays

    • Cell culture models: Transfection efficiency comparisons with conventional methods

    • In vivo proof-of-concept: Targeted delivery to specific tissues

The T4 phage system described in achieved nearly 100% delivery efficiency of genes and proteins into mammalian cells, suggesting that similar high efficiencies might be possible with engineered pIV-based systems.

What role might pIV play in understanding and overcoming phage resistance mechanisms?

Understanding pIV's role in phage resistance mechanisms has significant implications for phage therapy and biotechnology:

  • pIV as a mediator of phage-host interactions:

    • Functions as a portal for phage export, making it a potential target for host resistance mechanisms

    • May interact with host defense systems like restriction-modification systems

    • Could be recognized by bacterial immune systems (CRISPR-Cas, etc.)

  • Potential resistance mechanisms targeting pIV:

    • Host mutations affecting pIV-membrane interactions

    • Expression of inhibitory proteins that block pIV channel formation

    • Modification of membrane composition to prevent pIV insertion

    • Production of periplasmic factors that interfere with pIV assembly

  • pIV evolution and counter-resistance strategies:

    • Sequence diversification to evade host recognition

    • Structural adaptations to function in different membrane environments

    • Acquisition of domains that neutralize host inhibitory factors

  • Parallels with type IV restriction enzyme (TIV-RE) interactions:
    Recent research has identified phage proteins that inhibit type IV restriction enzymes, termed type IV restriction inhibiting factors (TIFs) . Similar dynamics may occur with pIV, where:

    • Phages might encode proteins that enable pIV to function despite host resistance

    • Host bacteria might produce factors specifically targeting pIV

    • Co-evolutionary arms races could drive rapid adaptation of both pIV and host factors

  • Experimental approaches to study resistance:

    • Evolution experiments to identify resistance mutations

    • Suppressor screens to find phage adaptations that overcome resistance

    • Protein-protein interaction studies to identify host factors interacting with pIV

  • Applications in phage therapy:

    • Engineering pIV variants that evade common resistance mechanisms

    • Developing combination approaches targeting multiple host barriers

    • Using pIV-based systems for delivery of antimicrobial compounds

Understanding these dynamics could help overcome bacterial resistance to phage therapy, particularly important in combating multidrug-resistant bacteria.

How do post-translational modifications affect pIV function and can they be manipulated for research applications?

Post-translational modifications (PTMs) of pIV represent an understudied aspect that may significantly influence its function and applications:

  • Known and predicted PTMs of pIV:

    • Potential glycosylation sites based on sequence analysis

    • Possible phosphorylation sites at serine/threonine residues

    • Disulfide bond formation in extracellular domains

    • Proteolytic processing during maturation

  • Functional implications of PTMs:

    • Effects on oligomerization and channel formation

    • Influence on gating dynamics and selectivity

    • Potential role in evading host immunity

    • Impact on stability and turnover in the membrane

  • Experimental approaches to study PTMs:

    • Mass spectrometry-based proteomic analysis of purified pIV

    • Site-directed mutagenesis of potential modification sites

    • Chemical labeling strategies to detect specific modifications

    • In vitro modification systems to generate defined PTM variants

  • Engineered PTMs for research applications:

    • Introduction of non-natural modifications for enhanced stability

    • Site-specific labeling for imaging applications

    • Glycoengineering to alter immunogenicity or targeting

    • Stimuli-responsive modifications for controlled function

  • Lessons from other phage systems:
    Recent research has shown that some mycobacteriophages have glycosylated capsid and tail proteins, which influence antibody production and recognition . This suggests that:

    • PTMs may be more common in phage proteins than previously recognized

    • Such modifications could affect host-phage interactions

    • Engineering specific PTMs might enhance phage-based applications

  • Methodological considerations for studying glycosylation:
    Based on approaches used with mycobacteriophages :

    • SDS-PAGE with glycoprotein-specific stains

    • Mass spectrometry to identify glycan structures

    • Genetic manipulation of glycosyltransferases

    • Immunological assays to detect effects on antibody recognition

  • Application-specific engineering of PTMs:

    • Therapeutic delivery: Modifications to enhance stability in vivo

    • Research tools: Site-specific labels for biophysical studies

    • Diagnostic applications: Engineered recognition elements

Understanding and manipulating PTMs of pIV could open new avenues for research and biotechnological applications of this versatile protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.