Recombinant Enterobacteria phage fd Attachment protein G3P (III)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Enterobacteria phage fd Attachment protein G3P (III), also known as gene-3-protein (G3P), is essential for filamentous phage propagation . It facilitates the entry of the viral genome into the bacterial host and its release from the host membrane . G3P consists of three domains:

  • CT domain Anchors G3P in the phage coat .

  • N2 domain Binds to the F pilus of Escherichia coli, initiating infection .

  • N1 domain Interacts with the TolA receptor to continue the infection process .

Function and Role

G3P mediates the adsorption of the phage to its primary receptor, the F-pilus, during initiation, and to the secondary receptor, domain III of the TolA protein . It plays essential roles in the penetration of the viral genome into the bacterial host via pilus retraction and in the extrusion process . The protein also forms the pIII-pVI virion cap and interacts with pVI (G6P), pVIII (G8P), and host TolA .

Production and Characteristics

Recombinant G3P can be produced in various hosts, including yeast . The recombinant protein typically has a purity level of greater than 90%, as determined by SDS-PAGE . It often includes an N-terminal 6XHis-Tag for purification purposes .

Table 1: Characteristics of Recombinant Enterobacteria phage M13 Attachment protein G3P (III)

CharacteristicDescription
Target NameIII
SynonymsGene 3 protein, G3P, Minor coat protein
SpeciesEnterobacteria phage M13 (Bacteriophage M13)
HostYeast
Protein TypeRecombinant Protein
Tag InfoN-Terminal 6XHis-Tagged
Theoretical MW44.6kDa
Purity>90% as determined by SDS-PAGE
Endotoxin LevelNot Tested
Expression Region19~424aa
Storage Buffer (Liquid)Tris/PBS-based buffer, 5%-50% glycerol
Storage Buffer (Lyophilized)Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage-20°C. Avoid repeated freeze/thaw cycles
RestrictionsFor Research Use Only. Not for use in diagnostic procedures .

Evolutionary Aspects and Homologues

Protein NameFunctionHomologues
pIII (G3P)Structural - Minor Virion Protein, Coat protein A - Adsorption Attachment proteinEnterobacteria phage f1 (P69169) 99.8% identity Enterobacteria phage Ike (P03663) 17.4% identity Pseudomonas phage Pf1 (P25129) 16.1% identity Pseudomonas phage Pf3 (P03624) 14.6% identity Xanthomonas phage ΦLf (Q37972) 15.9% identity Pseudomonas phage Pf4 (Q9I5K4) 17.1% identity ORF9 Ralstonia phage Rsm1 (A0JC13) 12.4% identity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Specify your preferred tag type during ordering for prioritized development.
Synonyms
III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-424
Protein Length
Full Length of Mature Protein
Species
Enterobacteria phage fd (Bacteriophage fd)
Target Names
III
Target Protein Sequence
AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPI GLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPAN PNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAY WNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSE GGGSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAID GFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPYVFG AGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES
Uniprot No.

Target Background

Function

Recombinant Enterobacteria phage fd Attachment protein G3P (III) plays crucial roles in both viral genome penetration and extrusion. During infection, G3P mediates phage adsorption to the F-pilus tip, followed by interaction with the host TolA receptor for DNA penetration. The C-terminal domain facilitates virion release from the cell during the extrusion process.

Database Links

KEGG: vg:22475004

Protein Families
Inovirus G3P protein family
Subcellular Location
Virion. Host membrane; Single-pass type I membrane protein. Note=Prior to assembly, G3P is found associated with the bacterial host inner membrane. There are about five copies of this protein per mature phage that are located on the head side of the filamentous virion.

Q&A

What is the structure and function of G3P in Enterobacteria phage fd?

G3P (gene-3-protein) is a crucial minor coat protein of filamentous phage fd that contains three distinct domains with specific functions. The protein's N-terminal domain (g3p-D1) features a six-stranded beta barrel topologically identical to a permutated SH3 domain, capped by an additional N-terminal alpha helix . This structural arrangement is essential for the protein's membrane penetration function.

The three domains of G3P include: the CT domain, which anchors G3P in the phage coat; the N2 domain, which binds to the F pilus of Escherichia coli to initiate infection; and the N1 domain, which continues the infection process by interacting with the TolA receptor . This three-domain architecture creates a protein that functions both in host recognition and membrane penetration during the infection cycle.

G3P plays multiple essential roles in the phage life cycle, including virion assembly and host infection. It forms the pIII-pVI virion cap and mediates both adsorption to receptors and release of the membrane-anchored virion from the cell via its C-terminal domain .

How does G3P mediate phage infection of E. coli?

The infection process mediated by G3P occurs through a multi-step mechanism involving receptor recognition and membrane penetration. Initially, G3P mediates adsorption of the phage to its primary receptor (F-pilus) during initiation of infection . Following this primary attachment, G3P engages with its secondary receptor (domain III of TolA protein) .

The N1 domain of G3P is essential for infection as it mediates penetration of the phage into the host cytoplasm, presumably through interaction with the Tol complex in the E. coli membranes . This two-receptor system ensures specificity of infection and efficient delivery of the phage genome into the host.

The tightly linked domain structure of G3P is critical for infectivity, as the protein must maintain connections between domains to properly coordinate the sequential steps of the infection process . This linked domain requirement has been exploited in protein engineering applications such as the Proside selection method .

What methodologies are used to express and purify recombinant G3P?

Recombinant G3P can be produced through several expression systems, with E. coli being the most common host. The gene encoding G3P or specific domains (such as N1-N2 fragments) is typically cloned into expression vectors with appropriate promoters and purification tags.

For structural and functional studies, researchers often express specific domains or fragments of G3P rather than the full protein. The N1-N2 fragments of wild-type gene-3-protein and selected variants can be purified and their stabilities towards thermal and denaturant-induced unfolding determined . This approach allows for detailed characterization of domain interactions and stability.

Purification typically involves affinity chromatography, taking advantage of fusion tags added to the recombinant protein. Additional purification steps may include ion exchange chromatography and size exclusion chromatography to achieve high purity required for structural studies.

When expressing G3P for phage display applications, the protein is genetically fused to antibody fragments such as single-chain variable fragments (scFv), often with a trypsin cleavage site incorporated as part of a peptide linker connecting the two proteins .

What methods have been used to enhance the stability of G3P for biotechnological applications?

The stability of G3P has been improved through directed evolution approaches, specifically using the Proside (protein stability increased by directed evolution) method. In this technique, G3P itself serves as both the selection platform and the target for stability enhancement .

The methodology involves subjecting phage without a guest protein to rounds of random in vivo mutagenesis followed by proteolytic Proside selections. Through this process, variants of G3P with one to four mutations can be selected, resulting in stepwise increases in the temperature at which the corresponding phage becomes accessible to proteases—from 40°C to almost 60°C .

Specific mutations that enhance stability have been identified, with the most effective ones occurring in domain N2 and its hinge subdomain . These findings provide a blueprint for rational design of stabilized G3P variants for applications such as improved phage display scaffolds.

This methodology exemplifies how evolutionary approaches can be used to optimize protein stability in a multi-domain context, revealing principles that can be applied to other complex protein systems.

How is G3P engineered for phage display applications?

In phage display technology, G3P serves as the primary fusion partner for displaying foreign proteins or peptides on the phage surface. The engineering of G3P for this purpose involves genetic fusion of the foreign protein (commonly an antibody fragment) to G3P, typically with a peptide linker containing a protease cleavage site .

System TypeCharacteristicsApplications
Phage VectorDirect cloning into phage genomeMultivalent display (3-5 copies)
Phagemid VectorMinimal plasmid with helper phageMonovalent display, larger libraries

For phage display experiments, G3P is genetically fused to human single-chain variable fragments (scFv) with a trypsin cleavage site incorporated as part of the peptide linker connecting the two proteins . This arrangement allows for selective release of displayed proteins when needed.

Two main systems exist for phage display: phage vectors and phagemid vectors. In phage vectors, antibody genes are cloned directly into the filamentous phage genome, potentially resulting in multivalent display of antibody-G3P fusion proteins . In contrast, phagemid vectors based on smaller "minimal plasmids" are often preferred for creating larger libraries due to higher transformation efficiencies .

Phagemid vectors contain three key elements: an antibiotic marker for selection and propagation, the gene encoding the antibody-G3P fusion protein, and regions of the M13 chromosome required for rolling circle amplification and production of the (+) DNA strand for packaging .

What structural features enable G3P to penetrate host cell membranes?

The membrane penetration mechanism of G3P relies on specific structural features in its N-terminal domain (g3p-D1). This domain contains a six-stranded beta barrel structure that is topologically identical to a permutated SH3 domain but is distinctively capped by an additional N-terminal alpha helix .

The solution structure of g3p-D1, determined by NMR spectroscopy, reveals how this domain is specialized for membrane interactions. The domain's arrangement suggests a conserved infection pathway for filamentous bacteriophages where specific structural features facilitate penetration through the bacterial membrane .

The interaction with the Tol complex in E. coli membranes appears crucial for the membrane penetration function. The N1 domain interacts with the TolA receptor, which is part of the Tol-Pal system spanning the cell envelope . This interaction likely induces conformational changes that facilitate the translocation of phage DNA across the membrane barrier.

Understanding these structural features has biotechnological relevance, as g3p-D1 represents the primary fusion partner in phage display technology . The domain's ability to facilitate membrane penetration while maintaining stability makes it an ideal scaffold for engineering novel cell-penetrating molecules.

How do evolutionary pressures shape G3P structure and function?

Evolutionary analysis of G3P reveals how selective pressures have optimized the protein for its dual roles in infection and phage assembly. The Evolutionary stabilization of G3P demonstrates how the protein has been fine-tuned to maintain the essential linkage between its three domains while optimizing domain stability .

Comparative analysis of G3P homologs across different filamentous phages shows varying degrees of sequence conservation. While G3P from Enterobacteria phage f1 shares 99.8% identity with G3P from Enterobacteria phage M13, it shows much lower identity with counterparts from other phages: 17.4% with Enterobacteria phage Ike, 16.1% with Pseudomonas phage Pf1, and 14.6% with Pseudomonas phage Pf3 .

This pattern of conservation suggests that while the core functional domains of G3P are preserved across filamentous phages, significant sequence divergence has occurred to adapt to different bacterial hosts. The conservation of structural elements despite sequence divergence highlights the functional constraints on G3P evolution.

The evolutionary stability of G3P domains reflects the balance between flexibility required for function and stability needed for maintaining protein integrity under environmental stresses . This balance provides insights into how multi-domain proteins evolve while preserving critical domain-domain interactions.

What techniques are used to study domain interactions in G3P?

Researchers employ several biophysical and biochemical techniques to characterize domain interactions in G3P. Thermal and denaturant-induced unfolding studies are particularly valuable for understanding how domains interact during protein denaturation . These studies have revealed the biphasic unfolding transitions characteristic of G3P's N1-N2 fragments.

NMR spectroscopy has been instrumental in determining the solution structure of G3P domains, particularly the N-terminal domain (g3p-D1) . This technique provides atomic-level resolution of protein structure and can detect dynamic interactions between domains.

X-ray crystallography has also contributed to our understanding of G3P structure, as evidenced by structures like 1FGP in the Protein Data Bank . These high-resolution structures reveal the precise arrangement of domains and their interfaces.

Mutagenesis coupled with functional assays provides another approach to study domain interactions. By creating variants with mutations at domain interfaces and assessing their impact on stability and function, researchers can map critical interaction networks . This approach has been particularly informative in identifying stabilizing mutations in the hinge subdomain connecting N1 and N2.

How can researchers optimize phage display protocols using G3P?

Optimizing phage display protocols involving G3P requires consideration of several factors that affect display efficiency and selection outcomes. The choice between phage and phagemid vectors is critical, with phagemid vectors offering advantages for larger libraries due to higher transformation efficiencies .

When using phagemid vectors, researchers must carefully select appropriate helper phage to provide the wild-type G3P that competes with the G3P-scFv fusion protein for incorporation into the phage . This competition affects the valency of display and can influence selection stringency.

The design of the linker region between G3P and the displayed protein or peptide significantly impacts display efficiency. Incorporating a protease cleavage site, such as the trypsin cleavage site shown in phage display experiments, allows for controlled release of the displayed molecule .

Expression conditions must be optimized to balance production of fusion proteins with maintaining phage infectivity. Over-expression of G3P fusion proteins can interfere with phage assembly and reduce infectious phage yields. Researchers often employ inducible promoters to control expression levels and timing.

Selection protocols should be designed with appropriate stringency to enrich for desired binding properties while minimizing background. Multiple rounds of selection with increasing stringency often yield the best results, allowing for progressive enrichment of high-affinity binders.

What are the current limitations in G3P engineering for phage display?

Despite its widespread use, G3P-based phage display faces several technical challenges. Proteolytic degradation of the fused antibody or peptide remains a significant issue, resulting in removal of a proportion of the displayed molecules . This degradation can lead to selection bias toward more stable but potentially less functional variants.

The competition between wild-type G3P (from helper phage) and G3P-fusion proteins affects display valency and can be difficult to control precisely . This variability impacts selection dynamics, particularly when selecting for low-affinity interactions that benefit from avidity effects.

The size limitations of proteins that can be efficiently displayed using G3P fusion present another challenge. Large proteins may interfere with G3P folding or phage assembly, reducing display efficiency or preventing phage production altogether.

The natural tropism of filamentous phage for F-pilus-positive E. coli limits the hosts that can be used for phage propagation . This constraint restricts the diversity of expression environments available for producing displayed proteins with post-translational modifications.

Addressing these limitations requires innovative approaches, such as engineering G3P variants with enhanced stability, developing new helper phage systems with modified G3P expression, and exploring alternative display scaffolds that complement G3P-based systems.

How might structural knowledge of G3P inform new phage-based technologies?

The detailed structural understanding of G3P domains and their interactions opens avenues for developing novel phage-based technologies. The membrane penetration capability of G3P's N-terminal domain could be exploited to design new cell-penetrating peptides or delivery systems for pharmaceuticals .

The modular nature of G3P suggests possibilities for domain swapping or chimeric protein design to create phage with altered host specificity. By replacing or modifying the N2 domain responsible for F-pilus binding, researchers might engineer phage to target different bacterial receptors or even eukaryotic cells.

Structure-guided engineering of G3P stability could enhance the robustness of phage display platforms. By incorporating stabilizing mutations identified through evolutionary and structural studies, researchers could create display systems that withstand harsh selection conditions or extended incubation times .

The natural role of G3P in mediating phage entry suggests potential applications in antimicrobial development. Peptides derived from G3P domains that interact with essential bacterial proteins like TolA could form the basis for new antibiotics that disrupt membrane integrity or essential transport functions .

Understanding how G3P domains assemble and interact provides a model for studying and engineering other multi-domain proteins. The principles learned from G3P stability studies could inform the design of stable multi-domain proteins for diverse biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.