Recombinant Enterobacteria phage fd Virion export protein (IV)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Enterobacteria Phage fd Virion Export Protein (IV)

Recombinant Enterobacteria phage fd Virion Export Protein (IV), also known as pIV (G4P), plays a crucial role in the assembly and export of bacteriophages . Specifically, it facilitates the extrusion of the virion by forming a gated channel across the outer membrane of the host bacterium . This protein belongs to the secretin family, which is commonly found in Gram-negative bacteria and is involved in type II and type III secretion systems, as well as type IV pilus assembly systems .

Function and Mechanism

The primary function of Virion Export Protein IV is to create a channel that allows the assembled bacteriophage to pass through the host's outer membrane . This channel is formed by 14 identical subunits that create a gated structure . Its function is essential for the release of the phage from the host cell.

Homologues and Interactions

Virion Export Protein IV interacts with pI (G1P), another protein involved in phage assembly . Homologues of pIV are found in various Enterobacteria phages, including f1 and Ike . Some filamentous phages from Gram-negative bacteria lack pIV, with its function being taken over by chromosomally encoded secretins or type IV secretion systems .

Table 1: Homologues of Virion Export Protein IV

Protein NameFunctionHomologues
pIV (G4P)Morphogenesis - Phage Assembly and Virion ExportEnterobacteria phage f1 (P03666)
Virion assembly-export proteinActs in the assembly and export of the bacteriophage by forming a gated channel across the host outer membrane.Enterobacteria phage Ike (P03667)
Interacts with pI (G1P).

Role in Phage Assembly

The absence of pIV, or its interacting partners like pI and pXI, can prevent phage assembly . In some phages, the function of pIV is fulfilled by host-encoded secretins, such as the epsD secretin in V. cholerae . Even in filamentous phages that infect Gram-positive bacteria, which lack an outer membrane, phage assembly occurs without phage or host-encoded secretins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
IV; Virion export protein; Gene 4 protein; G4P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-426
Protein Length
Full Length of Mature Protein
Species
Enterobacteria phage fd (Bacteriophage fd)
Target Names
IV
Target Protein Sequence
QVIEMNNSPLRDFVTWYSKQTGESVIVSPDVKGTVTVYSSDVKPENLRNFFISVLRANNF DMVGSIPSIIQKYNPNSQDYIDELPSSDIQEYDDNSAPSGGFFVPQNDNVTQTFKINNVR AKDLIRVVELFVKSNTSKSSNVLSVDGSNLLVVSAPKDILDNLPQFLSTVDLPTDQILIE GLIFEVQQGDALDFSFAAGSQRGTVAGGVNTDRLTSVLSSAGGSFGIFNGDVLGLSVRAL KTNSHSKILSVPRILTLSGQKGSISVGQNVPFITGRVTGESANVNNPFQTVERQNVGISM SVFPVAMAGGNIVLDITSKADSLSSSTQASDVITNQRSIATTVNLRDGQTLLLGGLTDYK NTSQDSGVPFLSKIPLIGLLFSSRSDSNEESTLYVLVKATIVRAL
Uniprot No.

Target Background

Function

This protein functions in bacteriophage assembly and extrusion by forming a channel across the host's outer membrane. This channel facilitates the passage of newly synthesized phage particles. Extrusion, a simultaneous assembly and secretion process, occurs at specific sites where the host's inner and outer membranes are in close proximity.

Database Links

KEGG: vg:22475007

Protein Families
Inovirus G4P protein family
Subcellular Location
Host membrane; Single-pass type I membrane protein.

Q&A

What is Enterobacteria phage fd Virion export protein (IV) and what is its primary function?

Enterobacteria phage fd Virion export protein (IV), designated as pIV (G4P), is a phage-encoded protein that acts in the assembly and export of filamentous bacteriophages by forming a gated channel across the host outer membrane. This protein is a critical component of the multi-protein complex that facilitates the export of newly assembled phage particles from infected bacterial cells. It specifically interacts with pI (G1P), which is an inner membrane component of the trans-envelope assembly/secretion system .

The protein functions as part of the assembly machinery that traverses the cell envelope and is composed of the inner membrane complex of pI and pXI alongside pIV in the outer membrane. This complex enables the non-lytic export of assembled phage particles, which is a distinctive characteristic of filamentous phages such as the Ff group (f1, fd, M13) .

How does pIV compare structurally and functionally to its homologues in other phages?

The pIV protein shows structural and functional homology across various filamentous phages of the Inovirus genus. Known homologues include:

PhageProtein IdentifierStructural/Functional Similarities
Enterobacteria phage f1P03666Nearly identical function and structure, forms outer membrane channel
Enterobacteria phage IkeP03667Similar channel-forming function with some sequence divergence

The functional conservation of pIV across different filamentous phages highlights its essential role in the phage life cycle. While maintaining core channel-forming capabilities, variations in sequence may reflect adaptations to different host cell membrane compositions or assembly requirements .

What are the established methods for studying pIV localization and membrane integration?

For investigating pIV localization and membrane integration, several complementary approaches are recommended:

  • Subcellular Fractionation: Separate bacterial inner and outer membranes using differential centrifugation with sucrose gradients to determine pIV localization.

  • Immunofluorescence Microscopy: Utilize antibodies specific to pIV coupled with fluorescent tags to visualize its spatial distribution in infected cells.

  • Protein Topology Analysis: Employ protease protection assays, where spheroplasts or intact cells are treated with proteases to determine exposed regions of pIV.

  • Membrane Integration Analysis: Use alkaline extraction methods to differentiate between integral membrane proteins (like pIV) and peripheral membrane-associated proteins.

To minimize experimental artifacts, it's critical to include appropriate controls such as known inner and outer membrane marker proteins (e.g., OmpA as an outer membrane control) .

How can researchers effectively express and purify recombinant pIV for structural studies?

Obtaining high-quality recombinant pIV presents challenges due to its membrane protein nature. The following methodological approach has proven successful:

  • Expression System Selection: Use Escherichia coli BL21(DE3) with a pET-based expression vector containing an N-terminal hexa-histidine tag and a solubility-enhancing domain like GB1.

  • Optimization of Expression Conditions: Induce expression at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) to minimize aggregation and inclusion body formation.

  • Membrane Protein Solubilization: Extract membranes and solubilize using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG).

  • Purification Strategy:

    • Perform affinity chromatography using Ni-NTA resin

    • Add NaCl (2 M) and urea (1 M) to the cleared lysate to remove contaminating RNA

    • Include size-exclusion chromatography as a final purification step using a Superdex 75 column equilibrated in buffer containing detergent

  • Quality Assessment: Verify protein homogeneity by SDS-PAGE and assess functionality through channel formation assays in liposomes .

What protein-protein interactions are critical for pIV function in phage assembly?

The functional assembly of pIV involves multiple protein-protein interactions forming a trans-envelope complex:

Interaction PartnerInteraction DomainFunctional Significance
pI (G1P)Inner membrane domainForms inner membrane component of assembly/export system
pXIN-terminal domain of pIProtects pI from cleavage by endogenous proteases
Host membrane proteinsOuter membrane domainsMay facilitate proper insertion into bacterial outer membrane

The interaction between pI and pIV is particularly crucial, as it connects the inner and outer membrane components of the export apparatus. This interaction must be precisely regulated to ensure proper timing of phage assembly and export. Mutations affecting these interaction interfaces significantly impair phage particle release, highlighting their essential nature .

How does the pIV-mediated export mechanism compare to other bacterial secretion systems?

The pIV-mediated export mechanism shares functional similarities with type IV secretion systems but operates with distinctive characteristics:

  • Structural Comparison: pIV forms a gated channel similar to secretins in type II and type III secretion systems, but with specialized adaptations for phage export.

  • Substrate Specificity: Unlike most bacterial secretion systems that transport proteins or DNA-protein complexes, pIV specifically facilitates the export of assembled phage particles consisting of DNA encapsulated in a protein coat.

  • Energy Requirements: While many bacterial secretion systems utilize ATP hydrolysis directly, phage export through pIV appears to rely on the energy derived from phage assembly processes at the inner membrane.

  • Gating Mechanism: pIV forms a channel that must open to allow phage passage but remain closed to maintain membrane integrity. This gating is likely controlled by interactions with other phage proteins rather than host regulatory mechanisms .

Understanding these similarities and differences provides insights into the evolution of macromolecular transport across bacterial membranes and potential applications in protein secretion biotechnology.

What are the molecular mechanisms governing the opening and closing of the pIV channel?

The gating mechanism of the pIV channel represents a complex area of research. Current models suggest:

  • Conformational Changes: The channel exists in closed and open conformations, with the transition likely triggered by specific protein-protein interactions during phage assembly.

  • Signal Transduction: Interactions with inner membrane components (pI/pXI) may transmit conformational signals that regulate channel opening.

  • Energetics: The energy driving channel opening may derive from the phage assembly process itself, creating a mechanical force that induces pIV conformational changes.

  • Potential Regulatory Elements:

    • Electrostatic interactions between charged residues

    • Hydrophobic gating regions that control channel permeability

    • Potential allosteric regulation sites that respond to phage assembly intermediates

Experimental approaches to investigate this mechanism include site-directed mutagenesis of predicted gating regions, electrophysiological measurements of channel conductance, and high-resolution structural studies using cryo-electron microscopy .

How do phages overcome the host cell envelope barrier during export, and what role does pIV play in this process?

The export of filamentous phages across the bacterial cell envelope represents a remarkable example of macromolecular transport that must overcome multiple barriers:

  • Inner Membrane Crossing: The phage assembly begins at the inner membrane, where the ssDNA-pV complex is packaged into virions as pV is replaced by pVIII (major coat protein).

  • Periplasmic Transit: The partially assembled phage must traverse the peptidoglycan layer of the periplasm.

  • Outer Membrane Passage: pIV forms a channel in the outer membrane that must accommodate the phage filament (approximately 6 nm in diameter and up to 900 nm in length).

The pIV protein plays several critical roles in this process:

  • Forms a size-selective channel compatible with phage dimensions

  • Maintains membrane integrity during export to prevent cell lysis

  • Potentially interacts with periplasmic components to facilitate passage through the peptidoglycan layer

  • May coordinate the timing of assembly with export to ensure efficient virion production

Recent research suggests that the peptidoglycan layer may undergo localized remodeling at the site of phage assembly, possibly through recruitment of host enzymes, though the exact mechanism remains under investigation .

What structural and functional similarities exist between pIV and proteins involved in viral RNA export in eukaryotic systems?

While pIV functions in bacteriophage export from prokaryotic cells, intriguing parallels can be drawn with viral RNA export mechanisms in eukaryotic systems:

  • Channel Formation: Both pIV and certain viral RNA export systems involve the formation of channels or pores through membranes, though in eukaryotes these are typically through the nuclear envelope rather than the cell membrane.

  • Regulatory Interactions: Similar to how pIV interacts with other phage proteins to regulate export, viral RNA export in eukaryotes often involves interactions between viral proteins and host export factors.

  • Functional Comparison with HIV Rev: The HIV-1 Rev protein, which mediates nuclear export of unspliced and singly-spliced viral mRNAs, shares functional parallels with pIV:

    • Both are virus-encoded facilitators of macromolecular transport

    • Both undergo oligomerization as part of their function

    • Both interact with other viral and host components to form functional export complexes

  • Structural Adaptations: While structurally distinct, both pIV and components of eukaryotic viral RNA export systems show specialized adaptations for their substrates, illustrating convergent evolution of transport mechanisms .

These comparisons highlight fundamental principles in viral transport mechanisms that transcend the prokaryote-eukaryote divide and offer potential insights for antiviral strategy development.

How can recombinant pIV be utilized as a tool in biotechnology and protein secretion systems?

The unique properties of pIV present several opportunities for biotechnological applications:

  • Protein Secretion Platform: The pIV channel can potentially be engineered to facilitate the export of recombinant proteins from bacterial cells, particularly for proteins that are challenging to purify by conventional methods.

  • Phage Display Applications: By understanding and manipulating the pIV-mediated export system, improvements in phage display technology can be achieved, particularly for the display of complex or larger proteins.

  • Nanopore Technology: The channel-forming ability of pIV makes it a candidate for engineered nanopores in applications such as single-molecule detection or DNA sequencing.

  • Drug Delivery Systems: Insights from pIV structure and function could inform the development of novel drug delivery vehicles that can traverse biological membranes.

Methodological considerations for these applications include:

  • Protein engineering to modify channel size and specificity

  • Integration with other components of the phage assembly machinery

  • Compatibility with different host cell systems

  • Stability and functionality in various experimental conditions .

What are the key considerations when designing experiments to study the kinetics of phage assembly and export through the pIV channel?

When investigating the kinetics of phage assembly and export, researchers should consider:

  • Temporal Resolution Methods:

    • Pulse-chase experiments with radioactive labeling to track the progression of phage proteins through the assembly pathway

    • Real-time fluorescence microscopy with tagged phage components to visualize assembly and export events

    • Time-resolved cryo-electron microscopy to capture assembly intermediates

  • Quantitative Measurements:

    • Phage production rates under different conditions

    • Accumulation of assembly intermediates in the presence of export inhibitors

    • Kinetic parameters of individual steps in the assembly-export pathway

  • Experimental Design Considerations:

    • Temperature and growth conditions significantly affect assembly kinetics

    • Host cell physiological state influences export efficiency

    • The ratio of phage proteins should be carefully controlled to prevent artifacts

  • Data Analysis Framework:

    • Mathematical modeling of the assembly-export pathway

    • Statistical analysis of single-particle tracking data

    • Comparative analysis across different phage strains or mutants

  • Potential Artifacts and Controls:

    • Overexpression of phage proteins may lead to aggregation or incorrect assembly

    • Protein tags may interfere with natural assembly processes

    • Appropriate controls should include non-functional pIV mutants and conditions where export is blocked at different stages .

What are the most effective approaches for analyzing mutations in pIV and their effects on phage assembly and export?

A comprehensive mutational analysis of pIV requires a multi-faceted approach:

  • Systematic Mutation Strategy:

    • Alanine-scanning mutagenesis across the entire protein

    • Targeted mutations of conserved residues identified through sequence alignment

    • Construction of chimeric proteins with homologous regions from related phages

    • Domain swapping experiments to identify functional regions

  • Functional Assays:

    • Phage production efficiency measurements

    • Electron microscopy to visualize phage accumulation in cells

    • In vitro channel formation assays using purified components

    • Protein-protein interaction assays to assess binding to pI and other partners

  • Structural Analysis of Mutants:

    • Circular dichroism spectroscopy to assess secondary structure changes

    • Limited proteolysis to identify conformational differences

    • Site-specific crosslinking to map interaction interfaces

    • High-resolution structural studies of key mutants

  • Data Integration Framework:

    Analysis LevelMethodsExpected Outcomes
    SequenceEvolutionary conservation analysisIdentification of critical residues
    StructureMolecular modeling, structural studiesLocation of mutation effects
    FunctionPhage production assays, export kineticsQuantitative impact on phage lifecycle
    MechanismChannel conductance, protein interactionsUnderstanding of molecular mechanism
  • Advanced Approaches:

    • Deep mutational scanning to comprehensively assess all possible amino acid substitutions

    • In vivo crosslinking mass spectrometry to map interaction networks

    • Single-molecule techniques to study individual channel properties

    • Molecular dynamics simulations to predict effects of mutations on channel dynamics .

How might new structural biology techniques advance our understanding of pIV function in the context of the complete phage assembly machinery?

Recent advancements in structural biology offer unprecedented opportunities to elucidate pIV function:

  • Cryo-Electron Tomography (cryo-ET):

    • Enables visualization of the entire phage assembly machinery in situ

    • Can capture different states of the export process in native cellular environments

    • May reveal previously unknown structural intermediates during phage assembly

  • Integrative Structural Biology Approaches:

    • Combining X-ray crystallography, cryo-EM, and NMR data with computational modeling

    • Integration of crosslinking mass spectrometry data to define protein-protein interfaces

    • Correlation with functional data to generate comprehensive structure-function models

  • Time-Resolved Structural Methods:

    • Time-resolved cryo-EM to capture conformational changes during channel opening

    • Triggered assembly systems to synchronize structural transitions

    • Correlation with kinetic data to establish a temporal sequence of assembly events

  • Super-Resolution Microscopy:

    • Single-molecule localization microscopy to track individual assembly events

    • Multi-color imaging to visualize different components simultaneously

    • Correlative light and electron microscopy to connect functional and structural data

These approaches could answer fundamental questions about:

  • The complete architecture of the trans-envelope export complex

  • Conformational changes during channel opening and closing

  • Coordination between inner and outer membrane components

  • Spatial organization of assembly sites within the bacterial envelope .

How does the host cell environment influence pIV function and phage export efficiency?

The host cellular environment significantly impacts pIV function through multiple mechanisms:

  • Membrane Composition Effects:

    • Lipid composition affects pIV insertion, folding, and channel properties

    • Changes in membrane fluidity with temperature impact export kinetics

    • Interactions with specific lipid species may regulate channel function

  • Host Protein Interactions:

    • Outer membrane proteins may compete for insertion machinery

    • Periplasmic chaperones may assist in pIV folding

    • Host proteases can affect pIV stability and turnover

  • Cell Envelope Stress Responses:

    • Phage infection activates envelope stress responses that can influence export

    • σE-dependent pathways may affect pIV expression or function

    • Two-component systems monitoring membrane integrity may respond to pIV insertion

  • Metabolic State Influences:

    • Energy availability affects export efficiency

    • Growth phase impacts membrane composition and protein expression

    • Nutrient limitation can alter cell envelope properties

  • Experimental Approaches to Study Host Factors:

    • Genetic screens for host mutations affecting phage export

    • Proteomic analysis of pIV-associated host proteins

    • Lipidomic profiling to identify lipids enriched at assembly sites

    • Comparative studies across different host strains with varying susceptibility .

Understanding these host factors could lead to improved phage production systems and insights into bacterial resistance mechanisms against filamentous phages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.