Recombinant Enterobacteria phage I2-2 Gene 1 protein (I)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
I; Gene 1 protein; G1P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Enterobacteria phage I2-2 (Bacteriophage I2-2)
Target Names
I
Target Protein Sequence
MAVYVVTGKLGAGKTLVAVSRIQRTLAKGGIVATNLNLKLHHFPQVGRYAKQCRVMRIAD KPTLEDLEAIGRGNLSYDESKNGLIVLDECGTWFNSRNWSDKSRQPVIDWFLHARKLGWD VIFIIQDISLMDKQAREALAEHVVYCRRLDKLNIPIIGGLISVLSGGRLPLPKVHFGIVK YGDNPQSLTVDKWIYTGTDLYAAYDTKQIFTSDRELSPPFCPVSPYYTHGIFAVKRDAKY YMRMTKIYFKKMNRVWLMASFLALGAGVGFFYKSRQINEQLSNMPVASAQANTTKTDHTI DELPRLSINSFAQMGYDVNVSFKDAKGKIYYSFDLMKSGYALDIKDSCHITLRKRNYIQQ VTCEG
Uniprot No.

Target Background

Function

Isoform G1P plays a crucial role in phage assembly, increasing the number of adhesion zones between the inner and outer host cell membranes. Phage extrusion occurs at these sites. It may collaborate with G4P in forming the zone for phage assembly and extrusion. Isoform G11P is also involved in phage assembly, likely contributing structurally to the formation of the phage assembly site.

Database Links

KEGG: vg:1260724

Protein Families
Inovirus G1P protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is Enterobacteria phage I2-2 Gene 1 protein and its primary function?

Enterobacteria phage I2-2 Gene 1 protein (I) is a full-length protein comprising 365 amino acids that functions primarily in bacteriophage replication processes. This protein belongs to the family of phage-encoded proteins expressed during the early stage of infection and is essential for viral DNA synthesis within the host cell. Gene 1 proteins typically initiate the viral DNA replication process by binding to specific DNA sequences and recruiting host cellular machinery for viral replication .

How does Recombinant Enterobacteria phage I2-2 Gene 1 protein compare structurally to Gene 1 proteins from other related phages?

Recombinant Enterobacteria phage I2-2 Gene 1 protein (365 amino acids) shows structural similarities to Gene 1 proteins from other Enterobacteria phages, including phage IKe (365 amino acids), phage If1 (353 amino acids), and phages M13 and f1 (both 348 amino acids). While these proteins share functional domains required for initiating phage DNA replication, the variations in sequence length suggest evolutionary adaptations to different host specificity or replication mechanisms . These structural differences may influence protein-protein interactions with host factors and affect the efficiency of viral replication in different bacterial hosts.

What expression systems are most commonly used for producing Recombinant Enterobacteria phage I2-2 Gene 1 protein?

E. coli is the predominant expression system for producing Recombinant Enterobacteria phage I2-2 Gene 1 protein, as evidenced by commercial preparations of this protein . This bacterial expression system offers several advantages including rapid growth, high protein yields, and compatibility with bacteriophage proteins. Similar to approaches used for other bacteriophage proteins, researchers typically use expression vectors like pET-series plasmids with appropriate restriction sites (such as NdeI or NcoI for the 5' end and XhoI for the 3' end), which allow for the addition of affinity tags (commonly His-tags) to facilitate purification .

What are the optimal conditions for expressing Recombinant Enterobacteria phage I2-2 Gene 1 protein in E. coli?

For optimal expression of Recombinant Enterobacteria phage I2-2 Gene 1 protein in E. coli, researchers should consider the following parameters:

  • Expression strain selection: Rosetta strains are recommended when expressing phage proteins due to their ability to supply tRNAs for rare codons that may be present in phage genomes, alleviating codon bias issues .

  • Vector optimization: pET-series vectors (such as pET-21a or pET-21d) with T7 promoter systems provide controllable, high-level expression .

  • Induction conditions: Typically, induction with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8, followed by expression at 16-25°C for 16-18 hours minimizes inclusion body formation.

  • Media composition: Enriched media like TB (Terrific Broth) or 2xYT often yield higher protein concentrations compared to standard LB media.

  • Harvest timing: Collection of cells 4-6 hours post-induction typically provides optimal balance between protein yield and solubility.

What purification strategy yields the highest purity for Recombinant His-tagged Enterobacteria phage I2-2 Gene 1 protein?

A multi-step purification strategy is recommended for obtaining high-purity (>85%) Recombinant His-tagged Enterobacteria phage I2-2 Gene 1 protein:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins with imidazole gradient elution (20-250 mM).

  • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 8.0) to separate based on charge properties.

  • Polishing step: Size exclusion chromatography using Superdex 75 or 200 columns to remove aggregates and achieve >95% purity.

  • Quality control: SDS-PAGE analysis should demonstrate purity greater than 85% as standard for research applications .

  • Buffer optimization: Final buffer composition (typically 20-50 mM Tris or phosphate, 100-300 mM NaCl, pH 7.5-8.0) should be optimized for protein stability and downstream applications.

Purification StepMethodExpected PurityRecoveryBuffer Conditions
CaptureNi-NTA IMAC>70%70-80%50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20-250 mM imidazole
IntermediateAnion Exchange>80%60-70%20 mM Tris-HCl pH 8.0, 50-500 mM NaCl gradient
PolishingSize Exclusion>90%85-95%20 mM Tris-HCl pH 7.5, 150 mM NaCl

How can researchers overcome solubility issues when expressing Recombinant Enterobacteria phage I2-2 Gene 1 protein?

To address solubility challenges with Recombinant Enterobacteria phage I2-2 Gene 1 protein:

  • Expression temperature reduction: Lowering expression temperature to 16-20°C slows protein synthesis, allowing more time for proper folding.

  • Co-expression with chaperones: Co-transforming with plasmids encoding chaperone proteins (GroEL/ES, DnaK/J) can enhance proper folding.

  • Fusion tag selection: Beyond His-tags, fusion partners such as MBP (maltose-binding protein), SUMO, or GST can dramatically improve solubility. These can be later removed using specific proteases if required for functional studies.

  • Lysis buffer optimization: Including mild detergents (0.1% Triton X-100), osmolytes (10% glycerol), or stabilizing agents (5-10 mM β-mercaptoethanol) in lysis buffers can improve initial solubility during extraction.

  • Refolding protocols: For proteins that form inclusion bodies despite optimization, established refolding protocols involving gradual dialysis from denaturing conditions can recover active protein.

What analytical methods are most effective for characterizing the structure of Recombinant Enterobacteria phage I2-2 Gene 1 protein?

Multiple complementary analytical approaches are recommended for comprehensive structural characterization:

  • Circular Dichroism (CD): Provides information about secondary structure composition (α-helices, β-sheets) and can monitor thermal stability.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines absolute molecular weight and oligomeric state in solution.

  • Differential Scanning Fluorimetry (DSF): Measures thermal stability and can screen buffer conditions for optimizing protein stability.

  • Limited Proteolysis: Identifies flexible or disordered regions and stable domains.

  • X-ray Crystallography or Cryo-EM: For high-resolution structural determination, though these require specialized equipment and expertise.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps solvent-accessible regions and protein dynamics.

How does the DNA-binding activity of Recombinant Enterobacteria phage I2-2 Gene 1 protein compare with Gene 1 proteins from related phages?

While specific comparative data for Enterobacteria phage I2-2 Gene 1 protein is limited in the provided research, DNA-binding activities of phage Gene 1 proteins typically show these characteristics:

  • Sequence specificity: Gene 1 proteins from different filamentous phages (including I2-2) recognize distinct DNA sequences at the origin of replication with varying affinities, reflecting host specificity.

  • Cooperative binding: Most Gene 1 proteins demonstrate cooperative binding to DNA, but the degree of cooperativity varies between phage types and may correlate with the efficiency of replication initiation.

  • Host factor interactions: The efficacy of DNA binding often depends on interactions with host factors, which may differ between Enterobacteria phage I2-2 and related phages like IKe or M13.

  • Structural determinants: Variations in DNA-binding domains between Gene 1 proteins from different phages (such as between I2-2's 365 amino acids versus M13's 348 amino acids) likely account for differences in binding affinity and specificity .

What functional assays are most informative for studying the enzymatic activity of Recombinant Enterobacteria phage I2-2 Gene 1 protein?

To comprehensively assess the enzymatic activities of Recombinant Enterobacteria phage I2-2 Gene 1 protein, researchers should employ:

  • DNA-binding assays: Electrophoretic mobility shift assays (EMSA) and fluorescence anisotropy to quantify binding to phage origin sequences.

  • Helicase activity assessment: If the protein possesses helicase activity, fluorescence-based unwinding assays using labeled double-stranded DNA substrates can measure ATP-dependent DNA unwinding.

  • ATPase activity measurements: Colorimetric malachite green assays or coupled enzyme assays can quantify ATP hydrolysis rates in the presence and absence of DNA substrates.

  • In vitro replication assays: Reconstituted systems containing purified host factors and phage proteins can assess the protein's ability to initiate DNA synthesis.

  • Protein-protein interaction studies: Pull-down assays or surface plasmon resonance (SPR) can identify and characterize interactions with host replication factors.

How can researchers optimize Recombinant Enterobacteria phage I2-2 Gene 1 protein for structural studies that require high protein concentration?

For structural studies requiring concentrated, homogeneous Recombinant Enterobacteria phage I2-2 Gene 1 protein:

  • Buffer screening: Systematically test various buffer compositions, pH values (7.0-8.5), salt concentrations (100-500 mM NaCl), and additives (glycerol, reducing agents) to identify conditions that maximize solubility at high concentrations.

  • Construct optimization: Design multiple constructs with varying N- and C-terminal boundaries to identify the most stable protein core for structural studies.

  • Tag position considerations: Compare N-terminal versus C-terminal His-tags, as tag position can significantly affect protein behavior at high concentrations.

  • Concentration methodology: Utilize centrifugal concentrators with appropriate molecular weight cut-offs (10-30 kDa), but concentrate gradually with intermittent centrifugation to avoid aggregation at the membrane surface.

  • Quality control: Apply dynamic light scattering (DLS) at each concentration step to monitor aggregation, and use SEC-MALS to confirm monodispersity before proceeding to structural studies.

What strategies can address the challenge of protein degradation during expression and purification of Recombinant Enterobacteria phage I2-2 Gene 1 protein?

To minimize degradation during expression and purification:

  • Protease inhibitor optimization: Include a comprehensive protease inhibitor cocktail in lysis buffers, targeting both serine and cysteine proteases (PMSF, EDTA, leupeptin, aprotinin, and pepstatin A).

  • Expression host selection: Consider using E. coli strains with reduced protease activity, such as BL21(DE3) pLysS or protease-deficient strains.

  • Temperature management: Maintain samples at 4°C throughout purification and avoid freeze-thaw cycles that can lead to degradation.

  • Protein stabilization: Add stabilizing agents such as 5-10% glycerol, 1-5 mM DTT or TCEP, and appropriate salt concentrations (typically 150-300 mM NaCl) to all buffers.

  • Rapid processing: Minimize the time between cell lysis and final purification steps, especially when working at room temperature during chromatography.

  • Western blot analysis: Use anti-His antibodies to identify degradation products and optimize purification conditions accordingly.

How can sequence variations between Enterobacteria phage I2-2 Gene 1 protein and homologous proteins from other phages affect experimental outcomes?

Sequence variations between Gene 1 proteins can significantly impact experimental outcomes through:

How does Recombinant Enterobacteria phage I2-2 Gene 1 protein interact with bacterial host proteins compared to Gene 1 proteins from other Enterobacteria phages?

The interaction patterns between Recombinant Enterobacteria phage I2-2 Gene 1 protein and bacterial host proteins likely differ from those of other phage Gene 1 proteins in several ways:

  • Binding affinity variations: The 365-amino acid length of I2-2 Gene 1 protein compared to the 348-amino acid length of M13 and f1 Gene 1 proteins suggests structural differences that may affect binding affinities to bacterial replication machinery components .

  • Host factor requirements: Different phage Gene 1 proteins often require specific host factors for optimal function. For example, while all may interact with bacterial DNA polymerase III, the strength and specificity of these interactions likely vary between I2-2 and other phages.

  • Regulatory interactions: The mechanisms by which host proteins regulate Gene 1 protein activity may differ between phage types, affecting replication efficiency and phage production.

  • Evolutionary adaptation: Sequence variations between I2-2 Gene 1 protein and homologs from other phages reflect evolutionary adaptations to different host environments, potentially resulting in distinct protein-protein interaction networks.

  • Structural basis: The extended length of I2-2 Gene 1 protein compared to some homologs suggests additional structural elements that may mediate unique host protein interactions.

What methodological approaches are most effective for studying the role of Recombinant Enterobacteria phage I2-2 Gene 1 protein in phage replication?

For comprehensive studies of I2-2 Gene 1 protein's role in phage replication:

  • In vitro reconstitution systems: Establish minimal replication systems containing purified bacterial replication proteins and Recombinant I2-2 Gene 1 protein to dissect functional mechanisms under controlled conditions.

  • Site-directed mutagenesis: Create strategic mutations in functional domains to correlate structure with function and identify critical residues for DNA binding, ATP hydrolysis, or host protein interactions.

  • Real-time replication assays: Develop fluorescence-based assays to monitor DNA synthesis in real-time, allowing kinetic analysis of the initiation and elongation phases of replication.

  • Cryo-EM analysis: Visualize complexes of I2-2 Gene 1 protein with DNA and host factors to determine structural arrangements during the replication process.

  • In vivo complementation studies: Express the recombinant protein in phage-infected bacteria where the endogenous gene has been inactivated to assess functional replacement capabilities.

  • Comparative biochemistry: Perform side-by-side functional assays with Gene 1 proteins from multiple phages (I2-2, IKe, M13) under identical conditions to pinpoint functional differences.

What are the key considerations when using Recombinant Enterobacteria phage I2-2 Gene 1 protein as a model system for studying viral-host interactions?

When using Recombinant Enterobacteria phage I2-2 Gene 1 protein as a model system:

  • Host factor variability: Consider how differences between bacterial strains (e.g., E. coli variants) may affect protein-protein interactions and experimental outcomes. The same recombinant protein may behave differently when interacting with host factors from different bacterial strains.

  • Physiological relevance: Ensure experimental conditions (pH, salt concentration, temperature) reflect the physiological environment of bacterial infection to obtain biologically relevant results.

  • Concentration effects: The stoichiometry between I2-2 Gene 1 protein and host factors is crucial; non-physiological protein concentrations may lead to artifacts in interaction studies.

  • Post-translational modifications: Evaluate whether relevant post-translational modifications present in natural infections are reproduced in recombinant systems, as these may influence function.

  • Structural considerations: The 365-amino acid length of the I2-2 Gene 1 protein provides structural features that may influence its interaction with host machinery differently than other phage proteins .

  • Evolutionary context: Interpret results within the evolutionary relationship between I2-2 and other Enterobacteria phages, acknowledging that mechanisms may be phage-specific rather than universal.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.