Recombinant Enterobacteria phage I2-2 Virion export protein (IV)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Enterobacteria phage I2-2 Virion export protein (IV), also known as Gene 4 protein (G4P), is involved in the assembly and extrusion of bacteriophages by creating a channel across the host's outer membrane . This channel facilitates the export of virions . The protein is produced using recombinant DNA technology .

Characteristics

CharacteristicDescription
Product TypeRecombinant Protein
SourceEnterobacteria phage I2-2 (Bacteriophage I2-2)
UniProt No.P15420
Tag InfoDetermined during the production process
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
StorageStore at -20℃; for extended storage, conserve at -20℃ or -80℃
NotesRepeated freezing and thawing is not recommended; store working aliquots at 4℃ for up to one week
AA SequenceEPVTLNNSPVRSFVQWYSSKTGKSVIVNPDVKGNITVFNADVNNANIDDFFKSVLNANGLVVVAGNPAVVSTPLTKLASQPSNEETYDDESDGVAYEAVPQSAAPAVPADLTVRNFNVTRVRSSDVLPLAKIFVDSNGGGNVVDYPGNNSLVVSGSAQVMPALSDFITSIDVAREQVLIQSLMFETSVSNGVDLSFALALASGGKVAGGFNTSALGTALSTAGGSFGIFNGNILALSLQAVQSDSNSKVISTPRILTQSGQSGYISVGQNVPFVTGKVTGEAASVNNPFQTIERRDVGVSLKVTPVVMGNGQLVLTIDTKADSLSNQAIASDIITNQRQIQTTVQIKDGQTLLLGGLISSNQFDSDRSVPFMSKIPLIGWLFRSHSDSKDDRTMFVLLTAHVIRAL
Protein NamesRecommended name: Virion export protein; Alternative name(s): Gene 4 protein; Short name= G4P
Gene NamesName: IV
Expression Region23-428
Sequence InfoFull length protein

Function and Role

Virion export protein (IV) functions in the assembly and export of bacteriophages . It forms a gated channel across the host outer membrane, facilitating the transit of virions . It interacts with pI (G1P), another protein involved in phage assembly .

Homologues

Homologues of Enterobacteria phage I2-2 Virion export protein (IV) include:

  • Enterobacteria phage f1

  • Enterobacteria phage IKe

  • Xanthomonas phage

  • Zot toxin V. cholerae

  • Zot-like Pseudomonas phage Pf4

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol utilizes 50% glycerol, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
IV; Virion export protein; Gene 4 protein; G4P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-428
Protein Length
Full Length of Mature Protein
Species
Enterobacteria phage I2-2 (Bacteriophage I2-2)
Target Names
IV
Target Protein Sequence
EPVTLNNSPVRSFVQWYSSKTGKSVIVNPDVKGNITVFNADVNNANIDDFFKSVLNANGL VVVAGNPAVVSTPLTKLASQPSNEETYDDESDGVAYEAVPQSAAPAVPADLTVRNFNVTR VRSSDVLPLAKIFVDSNGGGNVVDYPGNNSLVVSGSAQVMPALSDFITSIDVAREQVLIQ SLMFETSVSNGVDLSFALALASGGKVAGGFNTSALGTALSTAGGSFGIFNGNILALSLQA VQSDSNSKVISTPRILTQSGQSGYISVGQNVPFVTGKVTGEAASVNNPFQTIERRDVGVS LKVTPVVMGNGQLVLTIDTKADSLSNQAIASDIITNQRQIQTTVQIKDGQTLLLGGLISS NQFDSDRSVPFMSKIPLIGWLFRSHSDSKDDRTMFVLLTAHVIRAL
Uniprot No.

Target Background

Function

This protein functions in bacteriophage assembly and extrusion by forming a channel across the host outer membrane. This channel facilitates the passage of newly synthesized phage particles. Extrusion, a simultaneous assembly and secretion process, occurs at specific sites where the host inner and outer membranes are in close proximity.

Database Links

KEGG: vg:1260716

Protein Families
Inovirus G4P protein family
Subcellular Location
Host membrane; Single-pass type I membrane protein.

Q&A

What is Enterobacteria phage I2-2 and what role does its Virion export protein (IV) play?

Enterobacteria phage I2-2 is a filamentous bacteriophage isolated from Pretoria sewage that forms turbid plaques varying from pinpoint to approximately 1 mm in diameter on host bacteria. As a filamentous virus, individual I2-2 virions show considerable variation in length . The phage demonstrates a limited spectrum of activity, specifically targeting strains harboring I2 plasmids, and is notably resistant to RNAase but sensitive to chloroform treatment .

The Virion export protein (IV) serves as a critical component of the phage secretion machinery. As a member of the secretin protein family, it forms the exit channel through which newly assembled phage particles are exported from the bacterial host cell . This protein is essential for the completion of the phage life cycle, allowing newly assembled virions to exit the host without causing cell lysis, which is characteristic of filamentous phages.

How does Virion export protein (IV) compare between different phages?

When comparing the Virion export protein (IV) from Enterobacteria phage I2-2 with that of related phages such as IKe, several significant similarities and differences emerge:

FeatureEnterobacteria phage I2-2Enterobacteria phage IKe
Amino acid length406 amino acids (23-428)407 amino acids (31-437)
N-terminal regionContains virus-specific sequencesContains virus-specific sequences
Conserved domainsSecretin family domainsSecretin family domains
Host specificityStrains harboring I2 plasmidsN-pilus bearing hosts
FunctionForms phage export channelForms phage export channel

The export protein from the IKe phage shares significant sequence homology with I2-2, particularly in functional domains while showing virus-specific variations in regions that may contribute to host range determination . Both proteins function as secretins facilitating phage egress without causing host cell lysis.

What are the optimal expression and purification methods for recombinant I2-2 Virion export protein (IV)?

The optimal expression system for Recombinant Enterobacteria phage I2-2 Virion export protein (IV) is the Escherichia coli bacterial expression system, which has been successfully employed for related phage proteins . For optimal expression and purification, researchers should consider the following protocol:

  • Expression Vector Selection: Use a vector containing an appropriate tag (typically His-tag) for downstream purification and a strong promoter like T7 .

  • Expression Conditions:

    • Culture temperature: 25-30°C (lower temperatures often improve proper folding)

    • Induction: IPTG concentrations between 0.1-0.5 mM

    • Post-induction time: 4-6 hours for optimal protein accumulation

  • Purification Strategy:

    • Initial lysis: Use sonication or French press in a Tris-based buffer (pH 8.0)

    • Affinity chromatography: Ni-NTA for His-tagged constructs

    • Secondary purification: Ion exchange chromatography

    • Final step: Size exclusion chromatography to obtain highly pure protein

  • Storage Conditions:

    • Optimal buffer: Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Storage temperature: -20°C for short-term and -80°C for long-term storage

    • Aliquoting is essential to avoid repeated freeze-thaw cycles

The recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage .

How can researchers validate the functionality of recombinant I2-2 Virion export protein (IV)?

Validating the functionality of recombinant I2-2 Virion export protein (IV) requires a multi-faceted approach:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm proper secondary structure

    • Size exclusion chromatography to verify oligomerization state

    • Native PAGE analysis to assess multimer formation capability

  • Assembly Assays:

    • In vitro reconstitution of secretin complexes using purified components

    • Electron microscopy visualization of assembled complexes

    • Channel formation verification using liposome-based conductance assays

  • Functional Complementation:

    • Trans-complementation of pIV-deficient phage mutants

    • Phage propagation efficiency measurement to quantify functional rescue

    • Host cell membrane localization studies using fluorescently tagged pIV variants

  • Interaction Studies:

    • Pull-down assays to verify interactions with other phage components

    • Surface plasmon resonance to measure binding affinities

    • Cross-linking studies to capture transient interactions during phage assembly

These validation approaches collectively provide comprehensive evidence of proper folding, assembly, and biological function of the recombinant protein.

How can Virion export protein (IV) be utilized in phage display technologies?

The Virion export protein (IV) plays a critical role in phage display technologies, although not as the display protein itself but rather as an essential component of the phage secretion machinery that enables successful phage particle production and export:

  • Integration in Phage Display Libraries:

    • While pIII is the typical fusion partner for displayed peptides/proteins , functional pIV is essential for proper phage assembly and release

    • Optimization of pIV expression levels helps balance phage production efficiency with display quality

    • Co-expression of wild-type and modified pIV can fine-tune the phage secretion process

  • Methodological Applications:

    • Library Generation: When generating phage display libraries, ensuring proper pIV function is crucial for maintaining high library diversity

    • Affinity Selection: During biopanning procedures, the structural integrity of pIV affects phage infectivity and propagation

    • Amplification: In phage amplification steps, pIV activity directly impacts the yield of phage particles carrying the selected variants

  • Engineering Approaches:

    • Modified pIV variants can be used to control the rate of phage egress

    • Conditional expression systems for pIV can create switchable phage production systems

    • Directed evolution of pIV itself can yield phage vectors with enhanced production characteristics

  • Advanced Applications:

    • Creating phage display systems with altered host ranges by modifying the secretin specificity

    • Developing hybrid secretion systems that combine features from different phage types

    • Integration with synthetic biology approaches for programmable bacteriophage production

The understanding of pIV function has contributed significantly to the evolution of phage display technology from its introduction by George Smith in 1977 to its current applications in various research fields .

What is the relationship between I2-2 Virion export protein (IV) and bacterial secretion systems?

The relationship between I2-2 Virion export protein (IV) and bacterial secretion systems represents a fascinating example of molecular mimicry and evolutionary adaptation:

  • Structural and Functional Homology:

    • Phage pIV belongs to the secretin protein family, which also includes components of bacterial type 2 secretion systems (T2SS) and type 4 pili (T4P)

    • The secretin proteins form similar ring-shaped multimeric complexes in the outer membrane of bacteria

    • These complexes create channels for the passage of macromolecular structures (pili, secreted proteins, or phage particles)

  • Mechanisms of Molecular Hijacking:

    • Some filamentous phages lack a dedicated secretin and instead utilize the host's secretion machinery

    • For example, Vibrio cholerae filamentous phages use the endogenous T2SS secretin EspD for phage secretion

    • Similarly, when MDAφ infects Neisseria meningitidis, it uses the endogenous type 4 pilus secretin PilQ

  • Evolutionary Adaptations:

    • Phage pI proteins have evolved to present periplasmic domains that mimic and/or displace secretin-binding domains of bacterial secretion systems

    • This represents an elegant example of molecular mimicry that allows phages to utilize host machinery

    • Unlike bacterial protein secretion, where secretins require organized interactions with cognate inner membrane machinery, phages have evolved simplified systems

  • Comparative Analysis of Secretin-Dependent Systems:

SystemSecretin ComponentInner Membrane ComponentsSecreted Structure
Filamentous PhagepIV or hijacked host secretinpI, pXI (minimal)DNA-protein filament
Type 2 SecretionGspD/OutDMultiple (GspE,F,L,M)Folded proteins
Type 4 PiliPilQMultiple (PilB,C,T,M)Protein pilus

This relationship highlights the evolutionary "ride sharing" strategy employed by filamentous phages, which contrasts with the more complex secretion machineries of their bacterial hosts .

What experimental approaches are recommended for studying I2-2 Virion export protein (IV) interaction with host factors?

To effectively study the interactions between I2-2 Virion export protein (IV) and host factors, researchers should employ a comprehensive experimental strategy combining genetic, biochemical, and imaging approaches:

  • Genetic Screening Approaches:

    • Bacterial two-hybrid systems to identify potential protein-protein interactions

    • Suppressor mutant screens to identify genetic interactions

    • Host gene knockout libraries to identify essential host factors

    • CRISPR interference screens to identify host genes affecting pIV function

  • Biochemical Interaction Studies:

    • Co-immunoprecipitation with tagged pIV to pull down interacting host proteins

    • Cross-linking followed by mass spectrometry (XL-MS) to capture transient interactions

    • Surface plasmon resonance (SPR) to measure binding kinetics of purified components

    • Isothermal titration calorimetry (ITC) for thermodynamic analysis of binding interactions

  • Structural Biology Approaches:

    • Cryo-electron microscopy of pIV complexes with host factors

    • X-ray crystallography of co-crystals when possible

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • NMR spectroscopy for analyzing dynamic interactions with smaller host factors

  • Cellular Localization Studies:

    • Fluorescence microscopy with fluorescently tagged pIV and host factors

    • Super-resolution microscopy to visualize nanoscale organization

    • Time-lapse imaging to track dynamic interactions during phage infection

    • Correlative light and electron microscopy (CLEM) for ultrastructural context

  • Functional Assays:

    • Phage propagation efficiency in hosts with modified putative interaction partners

    • In vitro reconstitution assays with purified components

    • Electrophysiology to measure channel activity when interacting with host factors

    • Liposome-based assays to study interactions in membrane environments

These complementary approaches provide a comprehensive understanding of how I2-2 Virion export protein (IV) interacts with bacterial host factors to facilitate phage egress.

What are the recommended protocols for studying the oligomeric state of I2-2 Virion export protein (IV)?

The oligomeric state of I2-2 Virion export protein (IV) is critical to its function as a secretin channel. The following methodologies are recommended for detailed characterization:

  • Analytical Ultracentrifugation (AUC):

    • Sedimentation velocity experiments: Run at 40,000-50,000 rpm at 20°C

    • Sample concentration: 0.2-1.0 mg/mL in Tris buffer (pH 7.5-8.0)

    • Data analysis: Use continuous c(s) distribution model for heterogeneity assessment

    • Expected results: Secretins typically form large oligomers with sedimentation coefficients >10S

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Column: Superose 6 or similar for large complexes

    • Buffer: Tris-based with 150 mM NaCl at pH 8.0

    • Sample preparation: Filter through 0.1 μm membrane before injection

    • Data analysis: Determine absolute molecular weight across elution peak

  • Native Mass Spectrometry:

    • Sample preparation: Buffer exchange to ammonium acetate (pH 7.5)

    • Ionization: Nano-electrospray ionization with gentle source conditions

    • Mass analyzer: Q-TOF with extended mass range

    • Data interpretation: Identify oligomeric species and determine stoichiometry

  • Negative Stain Electron Microscopy:

    • Sample preparation: 0.01-0.05 mg/mL on glow-discharged carbon grids

    • Staining: 2% uranyl acetate or uranyl formate

    • Image acquisition: 80-120 kV with 40,000-60,000× magnification

    • Analysis: 2D classification and, if possible, single particle reconstruction

  • Cross-linking Mass Spectrometry:

    • Cross-linkers: BS3 or DSS (10-50 fold molar excess)

    • Reaction conditions: 30 minutes at room temperature

    • Sample processing: Tryptic digestion followed by LC-MS/MS

    • Data analysis: Identification of inter-subunit cross-links to map oligomeric interfaces

These complementary approaches provide a comprehensive characterization of the oligomeric state, which is essential for understanding the structural basis of pIV function in phage secretion.

How can researchers effectively compare the properties of I2-2 Virion export protein (IV) with homologs from other phages?

Effective comparison of I2-2 Virion export protein (IV) with homologs requires a systematic approach combining computational and experimental methodologies:

  • Sequence-Based Comparative Analysis:

    • Multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Conservation analysis with ConSurf to identify functionally important residues

    • Phylogenetic tree construction to establish evolutionary relationships

    • Domain architecture analysis using InterProScan or SMART

  • Structural Comparison:

    • Homology modeling of unresolved structures using Phyre2 or SWISS-MODEL

    • Superimposition of available structures using PyMOL or UCSF Chimera

    • Quantitative comparison of structural features (RMSD values)

    • Electrostatic surface potential comparison to identify functional differences

  • Functional Characterization:

    • Complementation assays in pIV-deficient phages across different hosts

    • Channel conductance measurements using planar lipid bilayers

    • Host range determination for phages expressing different pIV homologs

    • Chimeric protein analysis to identify host-specificity determinants

  • Comparative Expression and Stability:

    • Parallel expression and purification under identical conditions

    • Thermal shift assays to compare thermal stability

    • Protease sensitivity assays to evaluate conformational differences

    • Oligomerization efficiency comparison using native PAGE

  • Interaction Profile Comparison:

    • Pull-down assays with tagged pIV homologs using standardized host lysates

    • Yeast two-hybrid screens against host protein libraries

    • Surface plasmon resonance to quantitatively compare binding affinities

    • Cross-linking mass spectrometry to map interaction networks

  • Comparative Data Representation:

PropertyI2-2 pIVIKe pIVOther HomologsAnalytical Method
Sequence identityReferenceX%Y%, Z%BLASTP, Clustal Omega
Thermal stability (Tm)X°CY°CZ°CDifferential scanning fluorimetry
Oligomerization stateX-merY-merZ-merNative MS, SEC-MALS
Host complementation++++++/-Phage propagation efficiency
Channel conductanceX pSY pSZ pSPatch clamp electrophysiology

This comprehensive approach enables researchers to identify both conserved features essential for the core secretin function and variable regions that may contribute to phage-specific properties such as host range.

How can I2-2 Virion export protein (IV) be utilized as a tool for studying bacterial membrane structures?

The I2-2 Virion export protein (IV) offers unique opportunities as a research tool for investigating bacterial membrane structures due to its natural function of forming stable, regulated channels:

  • Membrane Protein Topology Probes:

    • Creating fusion proteins between pIV domains and reporter proteins

    • Mapping membrane protein topology using proteolytic accessibility assays

    • Developing pIV-based FRET sensors for membrane dynamics studies

    • Using pIV as a scaffold for positioning detection moieties at specific membrane locations

  • Nanopore Sensing Applications:

    • Engineering pIV channels with altered selectivity for single-molecule detection

    • Developing biosensors for small molecule or ion detection in bacterial membranes

    • Creating stochastic sensing platforms based on pIV pore conductance

    • Studying molecular transport across bacterial membranes using modified pIV channels

  • Membrane Organization Studies:

    • Using fluorescently labeled pIV to track membrane domain organization

    • Investigating lipid-protein interactions in bacterial outer membranes

    • Applying super-resolution microscopy to visualize pIV distribution and clustering

    • Studying the impact of membrane composition on secretin assembly and function

  • Protein Secretion Research:

    • Developing hybrid secretion systems with pIV components for protein export

    • Creating conditional export systems based on engineered pIV variants

    • Studying the minimal requirements for protein translocation across membranes

    • Comparing mechanisms of filamentous phage egress with bacterial protein secretion

  • Membrane Disruption Assessment:

    • Using pIV assembly as a reporter for membrane stress responses

    • Evaluating antimicrobial compounds that target outer membrane organization

    • Developing screening platforms for compounds that interfere with secretin assembly

    • Studying the impact of membrane-targeting drugs on protein complex formation

These applications leverage the unique properties of pIV as a naturally evolved membrane protein that forms stable, regulated channels in bacterial outer membranes.

What are the potential applications of I2-2 Virion export protein (IV) in synthetic biology?

I2-2 Virion export protein (IV) offers significant potential for synthetic biology applications, particularly in designing novel cellular export systems and programmable molecular transport:

  • Engineered Cellular Export Systems:

    • Designing minimal secretion systems using pIV as the outer membrane component

    • Creating orthogonal export pathways for specific recombinant proteins

    • Developing inducible secretion systems with regulated pIV expression

    • Engineering cells with enhanced protein secretion capabilities for biotechnology applications

  • Programmable Molecular Filters:

    • Modifying the pIV channel to create size-selective or charge-selective filters

    • Developing cellular biosensors based on selective transport through engineered pIV channels

    • Creating synthetic cellular compartments with controlled molecular exchange

    • Engineering bacterial cells with novel permeability characteristics

  • Phage Engineering Applications:

    • Developing phage variants with expanded host ranges through pIV engineering

    • Creating phage-based delivery systems for specific molecular cargo

    • Engineering controlled phage release systems for phage therapy applications

    • Developing synthetic phages with novel properties for biotechnology applications

  • Cell Surface Display Platforms:

    • Using pIV-based systems for displaying proteins on bacterial surfaces

    • Creating cellular biosensors with surface-displayed recognition elements

    • Developing vaccine platforms based on engineered bacteria

    • Engineering multicellular interactions through surface-displayed signaling proteins

  • Minimal Cell Design:

    • Incorporating pIV-based secretion systems in minimal cell designs

    • Exploring the minimal requirements for protein export in synthetic cells

    • Creating artificial cellular envelopes with controlled permeability

    • Developing chassis cells with simplified but functional envelope systems

These synthetic biology applications leverage the structural simplicity of phage secretion machinery compared to endogenous bacterial systems, offering opportunities for creating minimal, efficient export systems for various biotechnological purposes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.