Recombinant Enterobacteria phage If1 Attachment protein G3P (III)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

The Attachment protein G3P (III), also known as Gene 3 protein or G3P, represents a crucial minor coat protein found in the Enterobacteria phage If1 (Bacteriophage If1). This protein is classified under the UniProt accession number O80297 and belongs to the broader family of phage attachment proteins . In its native context, G3P functions as a structural component that contributes to both the physical architecture of the bacteriophage and its infection mechanism. The mature protein spans amino acids 17-460 of the full sequence, reflecting post-translational processing that occurs during phage assembly .

The official gene designation is "III" with G3P used as a synonym in various research contexts . Within bacteriophage taxonomy, it represents a key component of filamentous phages that infect Gram-negative bacteria, particularly members of the Enterobacteriaceae family . This classification is significant for understanding its evolutionary relationships and functional conservation across different phage species.

Evolutionary Relationships

Comparative sequence analysis reveals significant homology between G3P from Enterobacteria phage If1 and related proteins from other bacteriophages. Table 1 presents these evolutionary relationships based on sequence identity percentages.

Homologous ProteinOrganismSequence IdentityUniProt ID
Attachment protein G3PEnterobacteria phage f199.8%P69169
Attachment protein G3PEnterobacteria phage IKe17.4%P03663
Attachment protein G3PPseudomonas phage Pf116.1%P25129
Attachment protein G3PPseudomonas phage Pf417.1%Q9I5K4
Attachment protein G3PPseudomonas phage Pf314.6%P03624
Attachment protein G3PXanthomonas phage ΦLf15.9%Q37972
ORF9Ralstonia phage Rsm112.4%A0JC13

The exceptionally high sequence identity (99.8%) between G3P from Enterobacteria phage If1 and Enterobacteria phage f1 suggests a recent evolutionary divergence or strong selective pressure to maintain structural and functional conservation. In contrast, the moderate to low sequence identities with G3P proteins from other bacteriophage genera reflect more distant evolutionary relationships while maintaining core functional domains . These homology patterns provide valuable insights into the evolutionary history and adaptation of attachment proteins across different bacteriophage lineages.

Role in Phage Infection

The G3P protein plays multiple essential roles during the bacteriophage infection cycle. During the initial step of infection, G3P mediates adsorption of the phage to its primary receptor, the tip of the host I-pilus . This primary attachment represents the first critical step in host recognition and specificity determination. Following this initial contact, G3P undergoes conformational changes that facilitate subsequent interactions with secondary receptors on the bacterial surface.

The penetration of viral DNA into the bacterial host occurs through a complex process involving pilus retraction. As the pilus retracts, the phage particle is drawn toward the bacterial cell surface, allowing G3P to interact with its secondary receptor, domain III of the bacterial TolA protein . This interaction triggers structural changes in both the phage and the bacterial membrane, ultimately resulting in the translocation of the phage genome into the host cytoplasm.

Experimental studies using recombinant G3P variants have demonstrated that mutations in specific domains can significantly alter infection efficiency, highlighting the precise structural requirements for successful host penetration .

Interaction with Host Receptors

The interaction between G3P and host receptors follows a sequential mechanism that ensures specificity and efficiency. Initially, the N2 domain of G3P binds to the tip of the bacterial F-pilus or I-pilus, triggering a conformational change that exposes the N1 domain . This structural rearrangement enables the N1 domain to subsequently interact with the TolA protein in the bacterial outer membrane.

The binding affinity between G3P and its receptors is highly specific, contributing to the host range restrictions observed among bacteriophages. In Enterobacteria phage If1, the G3P protein demonstrates distinct binding characteristics compared to related phages like fd, despite their high sequence similarity. Research by Lorenz et al. (2011) demonstrated that Enterobacteria phages fd and If1 utilize different mechanisms to infect Escherichia coli, underscoring the subtle structural variations that can profoundly influence receptor specificity .

G3P interacts with multiple phage proteins during its functional cycle, including pVI (G6P) and pVIII (G8P), forming important structural complexes that maintain phage integrity and enable successful infection .

Participation in Phage Assembly and Release

Beyond its role in infection, G3P also contributes significantly to phage assembly and release processes. During virion assembly, G3P forms part of the pIII-pVI virion cap, a structure essential for proper phage morphology . The formation of the G3P-G6P complex is critical for correct termination of filamentous phage assembly and formation of this virion cap.

In the extrusion process, G3P mediates the release of the membrane-anchored virion from the bacterial cell via its C-terminal domain . This function is particularly important for filamentous phages, which are released without lysing their host cells. The C-terminal domain anchors G3P in the phage particle through hydrophobic interactions with the major coat protein G8P, while also participating in the membrane interactions required for phage release .

The complex mechanisms of assembly and release involve coordinated interactions among multiple phage proteins, with G3P playing a central regulatory role in these processes. These functions highlight the multifaceted nature of G3P as both a structural and functional component of the bacteriophage lifecycle.

Expression Systems

Recombinant Enterobacteria phage If1 Attachment protein G3P (III) can be produced using various expression systems, each offering distinct advantages for different research applications. Table 2 summarizes the primary expression systems employed for G3P production.

Expression SystemFeaturesProduct Code Examples
E. coliHigh yield, cost-effective, suitable for structural studiesCSB-EP526801ELA1 , MBS7070629
YeastEnhanced post-translational modifications, reduced endotoxinCSB-YP526801ELA1
BaculovirusComplex folding, suitable for functional studiesCSB-BP526801ELA1
Mammalian CellOptimal folding and modifications, lowest immunogenicityCSB-MP526801ELA1

The recombinant protein is typically produced with affinity tags to facilitate purification. Common tag configurations include N-terminal His-tags, though the specific tag type may be determined during the production process based on tag-protein stability considerations .

Purification Methods

Purification of recombinant G3P typically follows established protocols for tagged recombinant proteins. The general purification workflow includes:

  1. Cell lysis using mechanical or chemical methods

  2. Clarification of crude lysate by centrifugation and/or filtration

  3. Affinity chromatography using the incorporated tag (e.g., His-tag)

  4. Optional secondary purification steps (ion exchange, size exclusion)

  5. Quality control analysis by SDS-PAGE and other analytical methods

The purified protein generally achieves >90% purity as determined by SDS-PAGE analysis . For applications requiring exceptionally high purity or specific modifications, additional purification steps may be incorporated into the protocol.

The final product may be formulated in different ways depending on intended use and stability requirements. Common formulations include:

  • Lyophilized powder for extended storage stability

  • Liquid formulation in Tris/PBS-based buffer with 6% Trehalose (pH 8.0)

  • Liquid containing 50% glycerol for cryoprotection

Physicochemical Properties

The recombinant G3P protein exhibits several important physicochemical properties that influence its handling, storage, and application. The mature protein has a calculated molecular weight of approximately 48,790 Da . This relatively large size reflects its complex multi-domain structure and functional versatility.

Proper storage of recombinant G3P is critical for maintaining its structural integrity and biological activity. Recommended storage conditions include:

  • Long-term storage at -20°C or -80°C

  • Working aliquots at 4°C for up to one week

  • Avoidance of repeated freeze-thaw cycles

For lyophilized preparations, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, optionally with the addition of 5-50% glycerol for cryoprotection . The protein demonstrates reasonable stability in solution when properly stored, though activity may gradually decrease over time even under optimal conditions.

Specialized formulations, including low endotoxin preparations and sterile filtration, are available for applications requiring heightened purity standards or in vivo use . These modifications enhance the versatility of recombinant G3P for diverse research and biotechnological applications.

Biotechnological Applications

The unique binding properties of G3P have been exploited for various biotechnological applications. Patent applications reveal its potential utility in diverse fields:

  1. Amyloid binding agents: Recombinant G3P has been investigated for its ability to bind amyloid structures, with potential applications in diagnosis and treatment of amyloidosis and related disorders .

  2. Reduced immunogenicity variants: Modified G3P sequences with reduced immunogenicity have been developed, expanding the potential for therapeutic applications .

  3. Fusion protein scaffolds: G3P serves as a structural scaffold for creating fusion proteins with novel functionalities .

These applications leverage the natural binding capabilities of G3P while introducing modifications that enhance its utility for specific biotechnological purposes. The available recombinant preparations, including His-tagged and biotinylated variants, further expand the toolkit available to researchers in this field .

Potential Therapeutic Relevance

Recent research has explored the potential therapeutic applications of G3P and its derivatives. The patent literature indicates interest in using modified G3P proteins for addressing various diseases and conditions, including:

  • Amyloidosis and amyloid-related disorders

  • Neurodegenerative diseases, particularly those involving protein aggregation

  • Novel targeted delivery systems based on G3P's receptor-binding properties

Patent US-9493516-B2 specifically describes G3P compositions for use as amyloid binding agents, suggesting potential diagnostic or therapeutic applications in conditions like Alzheimer's disease . Similarly, patent US-9988444-B2 discusses polypeptides comprising modified bacteriophage G3P amino acid sequences with reduced immunogenicity, addressing a key challenge for therapeutic protein development .

The ability to produce recombinant G3P with various tags and in different expression systems provides flexibility for developing these therapeutic applications. The availability of mammalian cell-expressed variants with potentially reduced immunogenicity is particularly relevant for therapeutic development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-460
Protein Length
Full Length of Mature Protein
Species
Enterobacteria phage If1 (Bacteriophage If1)
Target Names
III
Target Protein Sequence
ATTDAECLSKPAFDGTLSNVWKEGDSRYANFENCIYELSGIGIGYDNDTSCNGHWTPVRA ADGSGNGGDDNSSGGGSNGDSGNNSTPDTVTPGQTVNLPSDLSTLSIPANVVKSDSIGSQ FSLYTNASCTMCSGYYLSNNADSIAIANITETVKADYNQPDMWFEQTDSDGNHVKILQNS YKAVSYNVESKQSDVNNPTYINYSYSVNVKQVSYDTSNVCIMNWETFQNKCDASRAVLIT DTVTPSYSRNITIQSNINYQGSNGSGGSGGSGGSGNDGGGTGNNGNGTGDFDYVKMANAN KDALTESFDLSALQADTGASLDGSVQGTLDSLSGFSDSIGGLVGNGSAISGEFAGSSAAM NAIGEGDKSPLLDSLSFLKDGLFPALPEFKQCTPFVFAPGKEYEFIIECKYIDMFKGIFA FILYFWTFVTVYDSFSGILRKGRG
Uniprot No.

Target Background

Function

Recombinant Enterobacteria phage If1 Attachment protein G3P (III) plays crucial roles in both viral genome penetration into the bacterial host via pilus retraction and virion extrusion. Initially, G3P mediates phage adsorption to the I-pilus tip. Subsequent interaction with the host entry receptor, TolA, facilitates viral DNA penetration into the host cytoplasm. Finally, during extrusion, G3P's C-terminal domain mediates the release of the membrane-anchored virion from the cell.

Database Links

KEGG: vg:1261855

Protein Families
Inovirus G3P protein family
Subcellular Location
Virion. Host membrane; Single-pass type I membrane protein. Note=Prior to assembly, G3P is found associated with the bacterial host inner membrane. There are about five copies of this protein per mature phage that are located on the head side of the filamentous virion.

Q&A

What is the structural organization of IF1 G3P and how does it differ from other phage attachment proteins?

In terms of structural stability, IF1-G3P compensates for the absence of stabilizing domain interactions (present in fd-G3P) through significantly increased stability of its individual domains. This represents an evolutionary adaptation that maintains protein robustness while allowing for permanent accessibility of the TolA binding site .

How does the infection mechanism of phage IF1 using G3P compare to other filamentous phages?

Phage IF1 employs a distinct infection mechanism compared to the well-studied phage fd. While both phages use a two-step process involving their respective G3P proteins, the molecular details differ significantly:

In phage fd, the infection process begins with the N2 domain of G3P attaching to an F pilus, followed by binding of the N1 domain to TolA-C. Importantly, in the resting state, N1 and N2 domains of fd-G3P are tightly associated, which makes the phage structurally robust but functionally noninfectious because the TolA-C binding site is buried at the domain interface. The binding of N2 to the F pilus triggers a series of conformational changes including partial unfolding, domain disassembly, and prolyl cis-to-trans isomerization in the hinge between N1 and N2, which activates the phage .

What receptors does IF1 G3P interact with during the infection process?

IF1 G3P interacts sequentially with two distinct receptors during the infection process:

  • Primary receptor: The N2 domain of IF1 G3P specifically recognizes and binds to I pili on the surface of susceptible bacteria. This interaction is highly specific and represents the initial attachment step that distinguishes IF1's host range from other phages like fd that target F pili .

  • Secondary receptor: After the initial binding to I pili, the N1 domain of IF1 G3P interacts with the C-terminal domain of the host TolA protein (TolA-C). Crystallographic and NMR analyses have revealed that phage IF1 interacts with the same site on TolA-C as phage fd, despite differences in other aspects of their infection mechanisms. This TolA interaction is critical for phage genome entry into the bacterial cell .

The permanently accessible configuration of the TolA binding site on N1 in IF1-G3P represents an evolutionary adaptation that enables efficient infection while maintaining structural stability through other mechanisms .

What methods are most effective for recombinant expression and purification of IF1 G3P?

For optimal recombinant expression of IF1 G3P, researchers should consider the following methodological approach:

  • Expression system: An E. coli expression system utilizing a T7 promoter-based vector (such as pET series) is recommended. BL21(DE3) or its derivatives are suitable host strains, particularly those optimized for membrane protein expression when working with full-length G3P.

  • Expression construct design:

    • For functional studies, expression of separate domains (N1 or N2) often yields better results than the full-length protein

    • Include an N-terminal His6-tag followed by a precision protease cleavage site for purification flexibility

    • Consider codon optimization for E. coli if expressing the full gene

  • Expression conditions:

    • Induction at lower temperatures (16-18°C) overnight after reaching OD600 of 0.6-0.8

    • IPTG concentration of 0.1-0.5 mM to prevent formation of inclusion bodies

    • Supplementation with glucose (0.5%) to suppress leaky expression

  • Purification protocol:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin as the initial capture step

    • Size exclusion chromatography as a polishing step

    • Consider ion exchange chromatography as an intermediate step if higher purity is required

During expression and purification, it's essential to monitor protein stability through dynamic light scattering and circular dichroism to ensure proper folding of the independently folding N1 and N2 domains characteristic of IF1 G3P.

How can recombinant IF1 G3P be used to study bacterial conjugation inhibition?

Recombinant IF1 G3P can serve as a valuable tool for studying bacterial conjugation inhibition, building on the established inhibitory effects of filamentous phage proteins on conjugation. Here's a methodological approach:

  • Preparation of recombinant protein:

    • Express and purify the soluble fragment of G3P (particularly the N2 domain)

    • Verify proper folding and activity through binding assays with isolated I pili

  • Conjugation inhibition assay:

    • Establish a baseline conjugation frequency between donor and recipient bacteria (typically using antibiotic resistance markers)

    • Add varying concentrations of purified G3P to the mating mixture

    • Quantify conjugation efficiency by counting transconjugants on selective media

    • Calculate inhibition rates compared to control conditions without G3P

  • Mechanistic investigation:

    • Compare inhibition effects of full-length G3P versus individual N1 and N2 domains

    • Use fluorescently labeled G3P to visualize binding to bacterial pili

    • Employ electron microscopy to observe physical occlusion of pili by G3P

Based on studies with related phage proteins, G3P likely inhibits conjugation by occluding the conjugative pilus, preventing the direct cell-to-cell contact necessary for plasmid transfer. Data from similar systems indicate that nanomolar concentrations of soluble G3P fragments can significantly inhibit conjugation, with potential applications in controlling the spread of antibiotic resistance genes .

What techniques can be used to study the binding kinetics between IF1 G3P and its receptors?

Several biophysical techniques can be employed to study the binding kinetics and affinity between IF1 G3P and its receptors:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified I pili or TolA-C on a sensor chip

    • Flow solutions of recombinant G3P at varying concentrations

    • Measure association (kon) and dissociation (koff) rate constants

    • Calculate equilibrium dissociation constant (KD)

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure the heat released or absorbed during binding

    • Determine thermodynamic parameters (ΔH, ΔS, ΔG) in addition to KD

    • Requires no immobilization or labeling of components

  • Microscale Thermophoresis (MST):

    • Label one binding partner (typically G3P) with a fluorescent dye

    • Measure changes in thermophoretic mobility upon binding

    • Requires small sample volumes and is suitable for membrane-associated receptors

  • Bio-Layer Interferometry (BLI):

    • Immobilize one binding partner on a biosensor tip

    • Dip into solutions containing the other partner

    • Monitor real-time binding through changes in interference pattern

    • Suitable for kinetic and steady-state analysis

When designing these experiments, it's important to consider the native conformational state of both G3P and its receptors. For I pili studies, intact pili isolation or the use of receptor mimics may be necessary. For the study of TolA-C interactions, the permanently accessible configuration of the TolA binding site on N1 in IF1-G3P should be considered when interpreting binding data .

How do the structural differences between IF1 G3P and fd G3P relate to their different infection mechanisms?

The structural differences between IF1 G3P and fd G3P directly correlate with their distinct infection mechanisms, representing remarkable evolutionary adaptations to achieve similar functional outcomes through different molecular strategies:

These structural differences appear to represent alternative evolutionary solutions to the same functional challenge: how to maintain protein stability while ensuring efficient infection. The fd phage employs a "switchblade" mechanism where domains are initially locked together (providing stability) but separate upon pilus binding (enabling infection). In contrast, IF1 phage maintains permanently separated domains but compensates with intrinsically more stable individual domains .

These differences demonstrate how evolution can solve similar functional problems through distinct structural strategies, and understanding these variations provides insights into protein engineering approaches for phage-based applications.

What are the key residues in IF1 G3P that mediate binding to I pili and TolA, and how do they differ from those in fd G3P?

Although the search results don't provide specific amino acid residues for IF1 G3P binding interactions, we can infer some important features based on comparative information:

For TolA binding:

For pilus binding:

  • The N2 domains of IF1 and fd G3P are unrelated , reflecting their specificity for different pilus types

  • This indicates a complete divergence in the binding interface for pilus recognition

  • The N2 domain of IF1 G3P has evolved specifically to recognize I pili rather than F pili

The key functional difference is that in fd G3P, the binding site for TolA-C is buried at the domain interface between N1 and N2, requiring a conformational change initiated by pilus binding to expose it. In contrast, in IF1 G3P, the TolA binding site on N1 is permanently accessible due to the independently folding nature of the N1 and N2 domains .

This architectural difference represents different evolutionary strategies to achieve infection specificity while maintaining protein stability.

How does the stability of recombinant IF1 G3P domains compare to those of other phage attachment proteins?

The stability characteristics of IF1 G3P domains represent a distinctive pattern compared to other phage attachment proteins, particularly those of fd phage:

This difference in stability strategy has important implications for recombinant protein production and engineering applications:

  • When expressing recombinant IF1 G3P domains individually, they are likely to be more stable and easier to work with than the corresponding domains from fd G3P.

  • The higher intrinsic stability of IF1 G3P domains may make them more resistant to engineering modifications that might destabilize other proteins.

  • The independently folding nature of IF1 G3P domains facilitates domain-swapping experiments for creating chimeric proteins with novel properties.

This stability difference exemplifies how evolution can achieve similar functional outcomes (robust phage particles capable of infection) through different structural strategies.

How can IF1 G3P be engineered for expanded host range or altered specificity?

Engineering IF1 G3P for expanded host range or altered specificity represents a promising approach for developing bacteriophage-based applications. Here's a methodological framework:

  • Structure-guided mutagenesis:

    • Target the N2 domain responsible for pilus binding

    • Introduce point mutations at the binding interface based on structural predictions

    • Create libraries of variants with randomized residues at key positions

    • Screen for altered binding specificity using bacterial binding assays

  • Domain swapping strategies:

    • Replace the N2 domain of IF1 G3P with corresponding domains from other phages

    • Create chimeric proteins combining elements from multiple phage attachment proteins

    • Maintain the N1 domain for TolA interaction while altering pilus specificity

  • Directed evolution approaches:

    • Develop a selection system where phage infection depends on successful engineering

    • Create large libraries of G3P variants through error-prone PCR or DNA shuffling

    • Apply selective pressure to identify variants with desired binding properties

    • Use iterative rounds of selection to optimize binding characteristics

  • Rational design based on receptor structure:

    • Analyze the structure of target bacterial pili

    • Identify potential binding interfaces through computational modeling

    • Design complementary binding surfaces on the N2 domain

    • Validate designs through binding assays and structural studies

These engineering efforts should take advantage of IF1 G3P's unique properties, particularly the independently folding nature of its domains, which may facilitate engineering efforts by reducing the risk of disrupting interdomain interactions that are critical in other phage attachment proteins like fd G3P .

What are the potential applications of recombinant IF1 G3P in controlling bacterial conjugation and antibiotic resistance spread?

Recombinant IF1 G3P holds significant potential for controlling bacterial conjugation and limiting the spread of antibiotic resistance genes. Based on research with similar phage proteins, several promising applications can be developed:

  • Conjugation inhibition:

    • Soluble fragments of G3P can inhibit bacterial conjugation at nanomolar concentrations

    • This effect likely occurs through occlusion of the conjugative pilus by G3P, preventing the cell-to-cell contact necessary for plasmid transfer

    • Since G3P specifically targets conjugative pili, it provides a targeted approach that doesn't disrupt normal bacterial physiology

  • Anti-resistance strategies:

    • Many antibiotic resistance genes are transmitted via conjugative plasmids

    • G3P-based conjugation inhibitors could serve as adjuvants to antibiotic therapy

    • Such inhibitors would not kill bacteria but would slow or prevent the horizontal spread of resistance genes

  • Environmental applications:

    • Treatment of hospital wastewater to reduce horizontal gene transfer

    • Application in agricultural settings where antibiotic use is prevalent

    • Potential use in aquaculture to limit resistance spread in closed systems

  • Diagnostic applications:

    • Labeled G3P could be used to detect bacteria expressing specific pili types

    • This could help identify potential sources of resistance gene spread

Importantly, since many antibiotic resistance factors confer susceptibility to phage infection through expression of conjugative pili (which serve as phage receptors), phage proteins like G3P represent a naturally evolved solution to targeting these conjugation systems . The specific binding properties of IF1 G3P to I pili would complement similar proteins from other phages that target different pilus types, potentially allowing for broad-spectrum conjugation inhibition strategies.

How does the recombinant expression of IF1 G3P differ from expression of other phage attachment proteins?

Recombinant expression of IF1 G3P presents distinct challenges and advantages compared to other phage attachment proteins, particularly those from fd phage:

  • Domain independence advantages:

    • The independently folding nature of IF1 G3P domains allows for more flexible expression strategies

    • N1 and N2 domains can be expressed separately with higher success rates

    • No need to maintain specific interdomain interactions that are critical in fd G3P

  • Protein stability considerations:

    • The higher intrinsic stability of individual IF1 G3P domains likely results in better expression yields

    • Reduced tendency to aggregate during expression and purification

    • Potentially greater tolerance to fusion tags and reporter proteins

  • Expression system optimization:

    • E. coli remains the preferred expression host due to codon usage compatibility

    • Lower expression temperatures (16-20°C) may still be beneficial to ensure proper folding

    • IPTG concentration can be optimized based on the specific construct

  • Purification strategy differences:

    • Simpler purification workflows due to more stable individual domains

    • Less concern about losing activity due to domain dissociation during purification

    • May tolerate harsher purification conditions compared to fd G3P

  • Functional validation approaches:

    • Activity assays must be designed to detect I pili binding rather than F pili binding

    • Different control proteins should be used when assessing specificity

The unique structural properties of IF1 G3P—particularly the permanently accessible TolA binding site and independently folding domains—make it potentially easier to work with in recombinant expression systems while still maintaining its functional properties for experimental applications .

How have filamentous phage attachment proteins evolved different mechanisms for host recognition while maintaining core functionality?

The evolution of filamentous phage attachment proteins represents a fascinating case of functional convergence through different structural and mechanistic paths. The comparison between IF1 G3P and fd G3P provides key insights into this evolutionary process:

Both proteins accomplish the same fundamental task—mediating phage attachment to bacterial host cells and facilitating genome entry—but they do so through remarkably different mechanisms that reflect their adaptation to different bacterial receptors.

Key evolutionary adaptations include:

This evolutionary divergence exemplifies how proteins can evolve different mechanisms to achieve similar functional outcomes, providing valuable insights for protein engineering approaches.

What are the challenges in crystallizing and determining the structure of IF1 G3P compared to other phage proteins?

Determining the crystal structure of IF1 G3P presents several unique challenges compared to other phage proteins:

  • Domain independence considerations:

    • While the independently folding nature of IF1 G3P domains can simplify expression, it may complicate crystallization

    • The flexible linker between domains likely introduces conformational heterogeneity

    • This flexibility, while functionally important, can inhibit crystal formation

  • Comparative crystallization strategies:

    • Crystallizing individual domains separately may be more successful than attempting full-length protein

    • The N1 domain may be easier to crystallize due to its similarity to fd G3P N1 domain (31% identity)

    • The unique N2 domain likely requires empirical screening of more crystallization conditions

  • Complexes for structural studies:

    • Co-crystallization with binding partners (TolA-C for N1, I pilus fragments for N2) may stabilize flexible regions

    • Antibody-mediated crystallization using Fab fragments could help trap specific conformations

    • Engineered constructs with reduced flexibility or surface entropy reduction may improve crystal quality

  • Alternative structural determination methods:

    • Cryo-electron microscopy may be more suitable for capturing the natural conformational flexibility

    • NMR studies of individual domains can provide dynamic information not available from crystal structures

    • Integrative structural biology approaches combining multiple techniques may be necessary

  • Specific structural features requiring attention:

    • The permanently accessible TolA binding site on N1 may create exposed hydrophobic patches that complicate crystallization

    • The absence of stabilizing domain interactions requires careful buffer optimization to prevent aggregation

These challenges highlight why structural studies often focus on individual domains or specific complexes rather than attempting to solve structures of entire multi-domain phage proteins in isolation.

How can computational approaches be used to predict the binding interface between IF1 G3P and bacterial receptors?

Computational approaches offer powerful tools for predicting and analyzing the binding interface between IF1 G3P and its bacterial receptors. A comprehensive computational strategy would include:

  • Homology modeling and structure prediction:

    • Generate structural models of IF1 G3P domains based on related phage proteins

    • Use AlphaFold2 or RoseTTAFold for ab initio prediction of poorly conserved regions

    • Refine models using molecular dynamics simulations to explore conformational flexibility

  • Protein-protein docking:

    • Perform rigid-body docking between G3P models and receptor structures (TolA-C, I pilus)

    • Apply flexible docking to account for conformational changes upon binding

    • Use ensemble docking approaches with multiple starting conformations to address flexibility

  • Binding hot spot identification:

    • Apply computational alanine scanning to identify key residues at the interface

    • Calculate binding free energy contributions using methods like MM-GBSA

    • Use evolutionary conservation analysis to identify functionally important residues

  • Molecular dynamics simulations:

    • Perform long-timescale simulations of G3P-receptor complexes to assess stability

    • Analyze binding pathway and kinetics using enhanced sampling techniques

    • Investigate conformational changes induced by binding

  • Machine learning approaches:

    • Train neural networks on known phage-receptor interactions to predict binding sites

    • Integrate sequence co-evolution data to identify potentially interacting residues

    • Apply deep learning models to predict binding affinity from structural features

  • Experimental validation design:

    • Prioritize predicted interface residues for mutagenesis studies

    • Design domain-swapping experiments based on computational predictions

    • Suggest specific labeled residues for FRET or spin-labeling experiments

These computational approaches can generate testable hypotheses about the interaction between IF1 G3P and its receptors, particularly valuable given the limited structural information available specifically for the IF1 system compared to better-studied phages like fd .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.