Recombinant Enterobacteria phage If1 Gene 1 protein (I)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its inclusion.
Synonyms
I; Gene 1 protein; G1P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Enterobacteria phage If1 (Bacteriophage If1)
Target Names
I
Target Protein Sequence
MAVYVVTGKLGAGKTLVAVGKIQDKIVSGCRVATNLDLRIHKLPRVGIFAKSPDVIRIPD KPSLDDLLAIGRGNNSYDENKNGLLVLDECGTWFNSRSWADKERQSVINWFLHARKLGWD IIFLIQDLSIMDKQARVALAEHVVYCRRLDKITIPFIGSIYSVITGSKLPLPKVHVGIVK YGDSPQSMTVERWTYTGRDLYAAYDTKQAFSDAYEHSSFSYLTPYLSHGRYAVKRDATFY MRLTRIYLKKYSRVLCLFCGFVSAFTYLSLSKPEATPQIKPVTTQIITSRYKPSELRITT SYRMGNAVGFEFMDAKKQKIASDDLIKDGFRMVYITPCSVELIKDGKHEKVTC
Uniprot No.

Target Background

Function

Isoform G1P plays a crucial role in phage assembly, increasing the number of adhesion zones between the inner and outer membranes of the host cell. Phage extrusion occurs at these adhesion sites. It may collaborate with G4P in forming the assembly and extrusion pathway. Isoform G11P is also involved in phage assembly, likely contributing structurally to the formation of the phage assembly site.

Database Links

KEGG: vg:1261857

Protein Families
Inovirus G1P protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the functional role of Enterobacteria phage If1 Gene 1 protein (G1P) in the phage life cycle?

Enterobacteria phage If1 Gene 1 protein (G1P) plays a crucial role in phage assembly by functioning as an inner membrane component of the trans-envelope assembly/secretion system. G1P increases the number of adhesion zones between the inner and outer membranes of the host cell, with phage extrusion occurring at these adhesion sites. The protein collaborates with G4P (pIV) in forming the assembly and extrusion pathway for newly formed phage particles . G1P is part of a trans-membrane complex along with pIV that facilitates virion assembly and export from the bacterial host.

How does If1 Gene 1 protein compare structurally and functionally to homologues in other phages?

If1 Gene 1 protein shows significant homology with proteins from several other phages:

HomologueIdentitySource
Enterobacteria phage f1 (P03657)99.7% identity
Enterobacteria phage IKe (P03658)50.1% identity
Xanthomonas phage (O55247)14.4% identity
Zot toxin V. cholerae (P38442)15.5% identity
Zot-like Pseudomonas phage Pf4 (Q9I5K2)13.6% identity

Functionally, these homologues all participate in phage assembly mechanisms, though the specific infection strategies may differ between phages. For example, filamentous phages like If1 and fd use different mechanisms to infect E. coli, despite sharing common receptor interactions with pilus and TolA .

What genetic engineering techniques are most effective for modifying the If1 Gene 1 sequence?

Several genetic engineering approaches have proven effective for modifying bacteriophage genes like If1 Gene 1:

  • CRISPR-Cas-based phage engineering: This system has been successfully employed for phage genome editing. The CRISPR-Cas9 complex specifically binds to the target site in the phage genome and creates a double-strand DNA break during phage infection. The mutations can be introduced via a donor plasmid, and the DNA break can be repaired by recombination with the donor to generate mutants of interest .

  • Bacteriophage Recombineering of Electroporated DNA (BRED): This technique exploits a phage-encoded recombination system such as the Red system of phage lambda and the RecE/RecT system of Rac prophage to enhance the frequency of homologous recombination . It allows for constructing gene deletions, replacements, and heterologous gene insertions .

  • Homologous recombination with CRISPR-Cas counterselection: This combined approach was demonstrated with T7 phage, where homologous recombination was first used to delete a nonessential gene, followed by CRISPR-based counterselection to enrich for the desired recombinant phages .

When engineering phage If1, the selection of technique should consider the efficiency of transformation in the host bacteria, as methods like BRED can be challenging in bacteria with low transformation efficiencies .

How can researchers assess the impact of mutations in If1 Gene 1 protein on phage assembly?

To assess the impact of mutations in If1 Gene 1 protein on phage assembly, researchers can employ multiple complementary approaches:

  • Phage titer analysis: Comparing the titer of mutant phages with wild-type to quantify assembly efficiency.

  • Electron microscopy: Direct visualization of phage particles to assess morphological changes resulting from Gene 1 protein mutations.

  • Conjugation inhibition assays: Since filamentous phages can inhibit bacterial conjugation, researchers can use conjugation experiments similar to those described for M13 phage . These involve co-culturing F+ (donor) and F- (recipient) cells and measuring conjugation rates in the presence of wild-type versus mutant phages.

  • Fluorescently-tagged host strains: Using bacterial hosts transformed with fluorescent markers (like eCFP and eYFP) to track infection dynamics and efficiency .

  • ELISA-based quantification: Developing ELISA assays to determine physical particle counts versus plaque-forming units, which can reveal assembly defects .

  • Protein-protein interaction studies: Investigating how mutations affect interactions with other phage proteins, particularly pIV (G4P), which is known to interact with G1P .

What experimental approaches best characterize the membrane topology of If1 Gene 1 protein?

To characterize the membrane topology of If1 Gene 1 protein, which functions as an inner membrane component of the trans-envelope assembly system, researchers should consider:

  • Cysteine scanning mutagenesis: Systematically introducing cysteine residues throughout the protein, followed by accessibility assays using membrane-impermeable thiol-reactive reagents.

  • GFP fusion analysis: Creating fusions of GFP to different regions of the protein and analyzing fluorescence localization within bacterial cells.

  • Protease protection assays: Exposing membrane fractions containing the protein to proteases, with and without membrane disruption, to determine which regions are accessible.

  • Cross-linking studies: Using chemical cross-linkers to identify interaction partners in the membrane environment.

  • Antibody accessibility assays: Using antibodies against specific epitopes to determine which regions are exposed on different sides of the membrane.

  • Computational prediction: Leveraging algorithms that predict transmembrane domains based on the amino acid sequence as a starting point for experimental validation.

What are the optimal expression systems for producing recombinant If1 Gene 1 protein?

Based on available research data, the following expression systems and considerations are recommended:

  • Expression host: E. coli expression systems are commonly used for recombinant phage proteins. As seen in product descriptions, E. coli has been successfully used to express recombinant Enterobacteria phage If1 Gene 1 protein .

  • Expression vectors: Vectors containing strong inducible promoters like T7 are often preferred for controlled expression.

  • Purification approach: His-tagged versions of the protein facilitate purification. The commercially available recombinant version includes a His-tag (MGSSHHHHHHSSGLVPRGSHMGSHM) at the N-terminus .

  • Solubility considerations: As a membrane protein, G1P may present solubility challenges. Expression at lower temperatures (16-25°C) and inclusion of appropriate detergents during purification are recommended.

  • Quality control: The expressed protein should be assessed for purity (>95%) and functionality, with SDS-PAGE and mass spectrometry being common verification methods .

How can researchers investigate If1 Gene 1 protein interactions with bacterial membrane components?

To study the interactions between If1 Gene 1 protein and bacterial membrane components, researchers should consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against G1P to pull down interacting membrane proteins, followed by mass spectrometry identification.

  • Bacterial two-hybrid systems: Modified to accommodate membrane protein interactions, these systems can identify potential binding partners.

  • Fluorescence resonance energy transfer (FRET): By tagging G1P and potential interaction partners with appropriate fluorophores, researchers can detect interactions in living cells.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify specific amino acid residues involved in protein-protein interactions.

  • Liposome binding assays: Reconstituting G1P in liposomes with defined lipid compositions to study membrane interactions.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding affinities between purified G1P and membrane components.

  • Cryo-electron microscopy: To visualize the structure of G1P in membrane environments and its interactions with other components of the phage assembly machinery.

How does the mechanism of phage If1 infection compare to other filamentous phages?

Phage If1 exhibits distinct infection mechanisms compared to other filamentous phages like fd, despite targeting similar receptors:

  • Receptor binding: Both If1 and fd phages first interact with a pilus and then target TolA as their common receptor. They use domains N2 and N1 of their gene-3-proteins (G3P) for these interactions .

  • Key differences in infection mechanism:

    • In G3P of phage If1, N1 and N2 domains function as independent modules that are permanently binding-active .

    • In contrast, G3P of phage fd exists in a closed state where N1 and N2 are tightly associated, making the TolA binding site inaccessible .

    • For fd phage to become infection-competent, partial unfolding and prolyl isomerization must occur to abolish the domain interactions and expose the TolA binding site .

  • Structural basis: Crystallographic and NMR analyses have shown that while phage If1 interacts with the same site on TolA-C as phage fd, the accessibility of this binding site differs between the two phages .

  • Stability compensation: The absence of stabilizing domain interactions in IF1-G3P is compensated for by a strong increase in the stabilities of the individual domains .

This demonstrates that closely related filamentous phages have evolved different mechanisms to balance robustness with high infectivity .

What roles does recombination play in the evolution of bacteriophage genes like If1 Gene 1?

Recombination plays a significant role in bacteriophage evolution, including genes like If1 Gene 1:

  • Rate of recombination vs. mutation: Studies on Siphoviridae phages have shown that recombination rates can exceed substitution rates. For example, one study estimated a constant substitution rate of 1.9 × 10^-4 substitutions per site per year due to mutation, but 4.5 × 10^-3 nucleotide alterations due to recombination per site per year .

  • Relative effect of recombination to mutation (r/m): The r/m ratio for certain phages has been estimated at approximately 24, which is homogeneous over time and considerably higher than the ratio observed in many bacterial species .

  • Functional consequences: Recombination events frequently lead to gene loss and regain, particularly in early transcriptional regions, demonstrating the role of phage group pangenomes as reservoirs of genetic variation .

  • Evolutionary implications: The observed substitution rate homogeneity conforms to the neutral theory of evolution, suggesting that the neutral theory can be applied to phage genome evolution and to genetic variation brought about by recombination .

  • Phage-host coevolution: Key phage genes involved in interactions with host bacteria, including those for DNA recombination, defense response, and DNA integration, show evidence of evolutionary selection pressure .

What are the current challenges in engineering functional variants of If1 Gene 1 protein?

Engineering functional variants of If1 Gene 1 protein presents several challenges:

  • Membrane protein complexity: As a membrane-associated protein involved in complex assembly processes, G1P variants may disrupt membrane topology and interactions critical for function.

  • Structural constraints: Modifications must preserve the protein's ability to interact with other phage components, particularly pIV (G4P), with which it forms the assembly/secretion system .

  • Selection methods: Identifying functional variants requires effective selection systems. CRISPR-Cas systems have shown promise for selecting engineered phages, but may require optimization for If1 phage specifically .

  • Screening challenges: The process of screening for functional mutants after recombination can be labor-intensive, requiring enrichment strategies to isolate desired variants from wild-type background .

  • Host range considerations: Modifications aimed at altering host range or infection properties must account for the complex interplay between multiple phage proteins and host factors.

  • Functional validation: Confirming that engineered variants maintain assembly function requires sophisticated assays that can distinguish between defects in different stages of the phage life cycle.

Researchers addressing these challenges can benefit from combining genetic engineering approaches with structural biology insights and high-throughput screening methods to develop functional If1 Gene 1 protein variants with desired properties.

How might If1 Gene 1 protein engineering contribute to phage therapy applications?

Engineering If1 Gene 1 protein could advance phage therapy in several ways:

  • Host range expansion: Modifications to G1P could potentially alter the assembly pathway to accommodate different host membrane architectures, expanding the range of bacteria susceptible to the phage.

  • Enhanced phage production: Optimizing G1P function could improve the efficiency of phage assembly and release, leading to higher phage yields for therapeutic applications.

  • Stability enhancements: Engineering G1P to improve the stability of phage particles could extend shelf-life and effectiveness of phage therapy preparations.

  • Reduced immunogenicity: Modifications might help reduce immune responses against therapeutic phages in clinical applications.

  • Combination with CRISPR-Cas delivery: Engineered phages with modified G1P could potentially serve as more efficient delivery vehicles for CRISPR-Cas systems targeting specific bacterial pathogens .

  • Biofilm penetration: Alterations to the assembly/export system involving G1P might be engineered to enhance phage penetration into bacterial biofilms.

What computational approaches are most valuable for predicting the effects of mutations in If1 Gene 1 protein?

Several computational approaches can help predict the effects of mutations in If1 Gene 1 protein:

  • Homology modeling: Leveraging the high sequence identity (99.7%) with Enterobacteria phage f1 G1P to model structural effects of mutations .

  • Molecular dynamics simulations: Simulating protein behavior in membrane environments to predict how mutations affect stability and interactions.

  • Evolutionary coupling analysis: Identifying co-evolving residues that may be functionally linked, helping predict which mutations might be tolerated.

  • Machine learning approaches: Similar to those used for identifying phage receptor-binding proteins, machine learning models could be trained to predict functional impacts of G1P mutations .

  • Protein-protein interaction prediction: Computational methods to predict how mutations might affect interactions with other phage proteins, particularly pIV.

  • Transmembrane topology prediction: Algorithms specifically designed to predict impacts on membrane protein topology can help assess whether mutations might disrupt critical membrane associations.

  • Integrative approaches: Combining multiple computational methods with experimental validation in an iterative fashion to refine predictions.

How can researchers reconcile contradictory findings regarding If1 Gene 1 protein function?

When faced with contradictory findings about If1 Gene 1 protein function, researchers should:

  • Examine experimental conditions: Different buffer compositions, temperatures, or expression systems can significantly affect membrane protein behavior and lead to apparently contradictory results.

  • Consider protein interactions: G1P functions in complex with other proteins; contradictions may arise when interaction partners are present in different studies at varying concentrations or conformational states.

  • Evaluate methodological differences: Direct comparisons between studies using different techniques may be inappropriate without accounting for methodological biases.

  • Perform reconciliation experiments: Design experiments specifically to test competing hypotheses under identical conditions.

  • Assess strain differences: Even minor genetic variations in host bacteria or phage strains can impact protein function; genome sequencing may reveal underlying causes of contradictory results.

  • Apply structural biology approaches: Crystal structures or cryo-EM studies can provide definitive insights into protein conformations under different conditions.

  • Consider evolutionary context: Comparing G1P function across related phages may clarify seemingly contradictory findings by placing them in an evolutionary context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.