Recombinant Enterobacteria phage If1 Virion export protein (IV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
IV; Virion export protein; Gene 4 protein; G4P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-429
Protein Length
Full Length of Mature Protein
Species
Enterobacteria phage If1 (Bacteriophage If1)
Target Names
IV
Target Protein Sequence
IPVELNNAPVREFVSWYSKTTGKPVIISPDVKGEITVYSADVTKDELPQFFTSVLRANGF DLSPGNPAVVQKFNRNTYEYSDSFSEPVPASSYDGDVPPPTGDFFTKPEIRANLITQTYP VNNVRAKDLAPVIDIFLKGENIAGTKVYPLMGRIFLLVTASASQHKELAAFFPSVDVPRT QVLVESVIFETTASDGFDFSFAAGDPSGSPVAGGINTDRLTSVLSSTGGSFGIFNGNILG LSLKALETSSKSTLLSMPRILTMSGQPGTFTAGQNVPFVTGRVTGEAANVNNPFQTIERH DVGISLKVVPVVTPGGLLIMDVSTNADSISDSQTASDIITNTRSISTTVQLKSGQTVLLG GMVDNRESDSDSSVPWVSKIPLIGALFTSKSSNANKRTLYILIRARVVNLL
Uniprot No.

Target Background

Function
Involved in bacteriophage assembly and extrusion, forming a channel across the host's outer membrane. This channel facilitates the passage of newly synthesized phage particles. Extrusion, a simultaneous assembly and secretion process, occurs at specific sites where the host's inner and outer membranes are in close proximity.
Database Links

KEGG: vg:1261858

Protein Families
Inovirus G4P protein family
Subcellular Location
Host membrane; Single-pass type I membrane protein.

Q&A

What is Enterobacteria phage F1 Virion Export Protein (IV) and what is its primary function?

Enterobacteria phage F1 Virion Export Protein (IV), also known as pIV or G4P, is a critical structural component of filamentous bacteriophages. The mature protein spans amino acids 22-426 and functions primarily in phage assembly and virion export mechanisms . At the molecular level, pIV acts by forming a gated channel across the host outer membrane, creating a specialized pore through which assembled phage particles can exit the bacterial host without causing cell lysis . This protein represents one of the essential components of the phage's trans-envelope assembly and secretion system, making it indispensable for productive phage infection cycles.

How does pIV relate to other filamentous phage proteins in the assembly process?

pIV functions as part of an integrated assembly system alongside several other phage proteins. Most critically, it interacts directly with pI (G1P), which serves as the inner membrane component of the trans-envelope assembly/secretion system . These two proteins form a molecular machine that spans the bacterial cell envelope. While pI anchors the assembly complex to the inner membrane, pIV creates the outer membrane pore.

The complete assembly process involves multiple phage proteins working in coordination:

  • pI and pXI form the inner membrane complex

  • pIV forms the outer membrane channel

  • pVII and pIX initiate the virion assembly process by interacting with the packaging signal of the viral genome

  • pVIII forms the major capsid structure

  • pIII and pVI form the virion cap and are involved in release mechanisms

This coordinated protein system allows the phage to assemble and export complete virions without causing bacterial cell lysis, a distinctive feature of filamentous phages.

What are the optimal storage and reconstitution conditions for recombinant pIV protein?

For optimal stability and functionality of recombinant Enterobacteria phage F1 Virion Export Protein (IV), the following storage and handling protocols are recommended:

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 30-50% and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 50%

  • Aliquot into smaller volumes to minimize freeze-thaw cycles

The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain structural integrity and function .

What expression systems yield the highest quality recombinant pIV protein for research applications?

For high-quality recombinant pIV protein production, E. coli expression systems have proven most effective. The commercially available recombinant protein is produced using E. coli with an N-terminal His-tag to facilitate purification . This system offers several advantages:

  • The bacterial expression system allows for proper folding of this bacterial phage protein

  • The His-tag enables efficient purification using metal affinity chromatography

  • E. coli's rapid growth and high protein expression levels make it cost-effective

When designing expression constructs, researchers should consider:

  • Including the mature protein sequence (amino acids 22-426) rather than the full-length protein that includes the signal peptide

  • Positioning affinity tags to minimize interference with protein function

  • Optimizing codon usage for E. coli expression

  • Controlling expression levels to prevent formation of inclusion bodies

Expression in other systems like yeast or insect cells is generally unnecessary as E. coli provides a homologous environment for this phage protein.

What purification methods are most effective for isolating functionally active pIV protein?

Purification of functionally active pIV protein requires careful consideration of its membrane protein characteristics. The following purification approach has proven most effective:

  • Initial extraction: Use mild detergents (n-dodecyl-β-D-maltoside or CHAPS) to solubilize the protein from membranes

  • Affinity chromatography: Utilize His-tag affinity purification with Ni-NTA or TALON resin

  • Size exclusion chromatography: Separate oligomeric forms and remove aggregates

  • Quality assessment: Verify purity via SDS-PAGE (>90% purity is achievable)

Critical considerations for maintaining functional activity:

  • Perform all purification steps at 4°C to minimize protein degradation

  • Include protease inhibitors in all buffers

  • Maintain physiological pH (7.5-8.0) throughout purification

  • Consider using stabilizing agents like glycerol or specific lipids in final formulations

  • Validate functional activity through channel formation assays

Researchers should note that pIV tends to form oligomeric structures essential for its function, so purification conditions should preserve these higher-order assemblies when functional studies are intended.

How does pIV contribute to the molecular mechanism of phage assembly and export?

pIV forms a critical component of the phage assembly and export machinery through a sophisticated molecular mechanism:

  • Channel formation: pIV oligomerizes to create a gated channel in the bacterial outer membrane approximately 6-8 nm in diameter, large enough to accommodate the filamentous phage structure (~6 nm)

  • Selective permeability: Unlike typical porins, the pIV channel functions as a selective gate that opens only during phage assembly, preventing cellular contents from leaking out while allowing phage export

  • Assembly complex formation: pIV forms a trans-envelope complex with pI (inner membrane) to create a continuous protected environment for phage assembly

  • Export energetics: The assembly-export process is driven by ATP hydrolysis, with energy coupling likely mediated through the pI-pIV interaction

The molecular process involves:

  • Initial assembly of phage structural proteins at the inner membrane

  • Coating of ssDNA with major coat protein pVIII as it passes through the inner membrane

  • Transfer of the assembling phage through the periplasm

  • Export through the pIV channel to the extracellular environment

This mechanism represents a remarkable example of macromolecular transport across the bacterial cell envelope without compromising membrane integrity or causing cell lysis .

What are the evolutionary relationships between pIV and homologous proteins in other filamentous phages?

Evolutionary analysis of pIV reveals fascinating relationships across various filamentous phages, demonstrating both conservation of function and adaptive diversification:

Based on sequence homology data, pIV from Enterobacteria phage f1 shows varying degrees of conservation with homologous proteins from other phages:

  • Highest homology (nearly identical) to equivalent proteins in closely related F-specific filamentous phages (M13, fd)

  • Moderate homology (~50.1% identity) with Enterobacteria phage IKe

  • Lower but significant homology with proteins from more distant phages:

    • Xanthomonas phage (14.4% identity)

    • Pseudomonas phages (~13-17% identity)

Interestingly, pIV also shares homology with bacterial virulence factors:

  • Zot toxin from Vibrio cholerae (15.5% identity)

  • Zot-like protein from Pseudomonas phage Pf4 (13.6% identity)

This evolutionary relationship suggests that phage export proteins and certain bacterial virulence factors likely share a common ancestral origin. The conservation of functional domains across diverse phages indicates the fundamental importance of the export mechanism in filamentous phage biology, while variations likely reflect adaptations to different bacterial hosts and environmental niches.

How does the structure-function relationship in pIV dictate its role in phage biology?

The structure-function relationship in pIV is central to understanding its biological role. Key structural features correlate directly with specific functions:

  • N-terminal domain: Contains sequences responsible for proper folding and initial assembly

  • Central domain: Forms the core of the channel structure through oligomerization

  • C-terminal domain: Contains regions that interact with other phage assembly proteins, particularly pI

The functional oligomeric pIV complex forms a multimeric channel (likely 12-14 subunits) that creates a selective pore. This structural arrangement is critical because:

  • The multimeric assembly provides the right diameter (~6-8 nm) for phage passage

  • The gated mechanism prevents cellular leakage while allowing phage export

  • The specific protein-protein interaction domains facilitate integration with other assembly components

Structural studies have shown that pIV belongs to the secretin family of proteins, which form gated channels in bacterial outer membranes. Unlike many secretins that require pilot proteins for proper localization, phage pIV can independently localize to the outer membrane, reflecting its specialized evolution for phage assembly .

Mutations affecting the oligomerization domains typically result in defective phage assembly, underscoring the critical nature of proper pIV structure for function.

What are common technical challenges when working with recombinant pIV protein and how can they be addressed?

Researchers working with recombinant pIV protein frequently encounter several technical challenges:

  • Limited solubility:

    • Issue: pIV tends to aggregate due to its membrane protein characteristics

    • Solution: Include 0.5-1% mild detergent (n-dodecyl-β-D-maltoside or CHAPS) in all buffers

    • Alternative: Use 6% Trehalose as included in commercial formulations

  • Loss of activity upon storage:

    • Issue: Functional activity decreases significantly after multiple freeze-thaw cycles

    • Solution: Store in small aliquots with 50% glycerol at -80°C

    • Alternative: Maintain working stocks at 4°C for up to one week

  • Incomplete oligomerization:

    • Issue: Recombinant protein fails to form functional oligomeric complexes

    • Solution: Include a refolding step during purification using a urea gradient

    • Alternative: Add specific lipids that promote proper oligomerization

  • Proteolytic degradation:

    • Issue: The protein is sensitive to proteolytic cleavage during purification

    • Solution: Include protease inhibitor cocktail in all buffers

    • Alternative: Perform all steps at 4°C and process samples quickly

For quality control, researchers should verify protein activity through channel formation assays rather than relying solely on protein purity assessments by SDS-PAGE .

How can researchers design appropriate controls for experiments involving pIV protein?

Designing appropriate controls is essential for generating reliable data when working with pIV protein:

Negative controls:

  • Denatured pIV protein: Heat-treated (95°C for 10 minutes) protein to serve as a non-functional control

  • Irrelevant membrane protein: Another membrane protein of similar size but unrelated function

  • Buffer-only conditions: Sample buffer with all components except the protein

Positive controls:

  • Known functional batch: Previously validated pIV preparation with confirmed activity

  • Native pIV extraction: When possible, native pIV extracted from phage-infected bacteria

  • Homologous protein: Functionally similar protein from a related phage system

Specificity controls:

  • Mutant variants: If available, pIV with point mutations in key functional domains

  • Truncated variants: pIV fragments lacking specific domains

  • Antibody blocking: Using specific antibodies to block particular domains

For interaction studies, researchers should include:

  • Pull-down assays with non-interacting proteins

  • Competition assays with excess unlabeled protein

  • Dose-response relationships to confirm specific binding

These controls help distinguish specific pIV-related effects from non-specific findings and ensure experimental rigor.

How should researchers interpret contradictory findings in pIV functional studies?

When facing contradictory results in pIV functional studies, researchers should systematically evaluate several factors:

  • Protein quality assessment:

    • Verify protein integrity by SDS-PAGE

    • Confirm oligomeric state by native PAGE or size exclusion chromatography

    • Assess potential degradation by mass spectrometry

    • Compare different protein preparations for consistency

  • Experimental condition variations:

    • Buffer composition differences (pH, salt concentration, detergents)

    • Temperature variations during experiments

    • Presence of contaminating proteins or bacterial components

    • Time-dependent effects on protein activity

  • Methodological differences:

    • In vitro versus in vivo approaches

    • Recombinant versus native protein sources

    • Different detection methods or assay sensitivities

    • Variations in data analysis approaches

  • Biological context:

    • Different bacterial strains or growth conditions

    • Presence of other phage proteins that might modulate pIV function

    • Genetic background differences in host systems

  • Resolution approaches:

    • Direct side-by-side comparison using standardized protocols

    • Collaborative cross-laboratory validation studies

    • Employing multiple complementary techniques to assess the same parameter

    • Systematic mutation analysis to identify critical functional residues

By methodically addressing these factors, researchers can often resolve apparent contradictions and develop a more comprehensive understanding of pIV function in different experimental contexts.

How does pIV compare to homologous proteins across different filamentous phage systems?

pIV (G4P) from Enterobacteria phage f1 shows interesting patterns of conservation and divergence across filamentous phage systems:

Phage SystemProtein HomologueSequence IdentityFunctional SimilaritiesStructural Differences
Enterobacteria phage IkepIV (G4P)50.1%Channel formation, virion exportModified host specificity determinants
Xanthomonas phagepIV homologue14.4%Basic channel structureAdapted to gram-negative Xanthomonas cell envelope
Pseudomonas phage Pf4Zot-like protein13.6%Channel-forming capabilityAdditional functions potentially related to virulence
Vibrio cholerae phage CTXZot toxin15.5%Membrane channel formationDual function as toxin and assembly protein

All these homologues maintain the core function of creating an export channel, but have evolved specific adaptations for their bacterial hosts. The moderate-to-low sequence identities despite functional conservation indicate that specific structural elements required for channel formation are preserved while other regions have diverged to accommodate host-specific interactions .

The protein's membrane-spanning domains show higher conservation than peripheral regions, reflecting the critical nature of the channel-forming function across diverse phage lineages.

What insights do structural studies provide about pIV channel formation and gating mechanism?

Structural studies of pIV and related secretins have revealed key insights into channel formation and gating mechanisms:

  • Oligomeric assembly:

    • pIV forms ring-like structures composed of 12-14 subunits

    • The oligomeric assembly creates a channel with inner diameter of approximately 6-8 nm

    • Channel size is precisely calibrated to accommodate the filamentous phage (~6 nm diameter)

  • Domain organization:

    • N-terminal domains face the periplasm and interact with other assembly proteins

    • Central domains form the core channel structure spanning the outer membrane

    • C-terminal domains contribute to gating and regulation of channel opening

  • Gating mechanism:

    • The channel exists primarily in a closed conformation to maintain membrane integrity

    • Conformational changes triggered by interactions with the assembling phage open the gate

    • The energy for gating likely comes from ATP hydrolysis mediated through the pI-pIV interaction

    • The gate prevents both inward and outward flow of molecules except during phage export

  • Structural homology:

    • pIV belongs to the secretin family of bacterial outer membrane proteins

    • Similar structural principles govern related secretins involved in type II and type III secretion systems

    • The phage system represents a specialized adaptation of this common structural motif

These structural insights help explain how pIV facilitates the remarkable process of exporting intact phage particles without compromising bacterial cell integrity, a key feature distinguishing filamentous phages from lytic phages.

How can pIV be utilized in biotechnology applications beyond basic phage research?

pIV offers several promising biotechnology applications beyond its role in phage biology:

  • Protein secretion systems:

    • Engineering pIV-based channels for controlled export of recombinant proteins

    • Creating hybrid secretion systems with modified specificity

    • Developing new protein display technologies using the phage assembly machinery

  • Nanopore technology:

    • Using pIV channels for single-molecule detection systems

    • Developing biosensors based on pIV pore conductance

    • Creating controlled release systems for drug delivery

  • Synthetic biology tools:

    • Incorporating pIV into synthetic microbial consortia for intercellular communication

    • Developing new controlled lysis systems for biotechnology applications

    • Engineering phage-inspired protein delivery systems

  • Molecular understanding of membrane transport:

    • Using pIV as a model system to study gated transport across biological membranes

    • Investigating protein-protein interactions in trans-envelope complexes

    • Developing new approaches to membrane protein structural biology

The unique properties of pIV—forming large but gated channels, selective transport capabilities, and integration with other assembly components—make it particularly valuable for these applications, especially when engineered with modern protein design approaches.

What are the current limitations in our understanding of pIV function and what future research directions might address them?

Despite extensive research, several limitations remain in our understanding of pIV function:

Current knowledge gaps:

  • Precise atomic-level structure of the assembled pIV channel

  • Molecular details of the gating mechanism

  • Complete characterization of the pI-pIV interaction interface

  • Energetics of phage export through the channel

  • Structural transitions during channel opening and closing

Promising future research directions:

  • Advanced structural studies:

    • Cryo-electron microscopy of the assembled pIV complex

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Single-particle analysis of channels captured in different functional states

  • Functional characterization:

    • Single-molecule studies of phage transport through pIV channels

    • Real-time imaging of channel dynamics during phage assembly

    • Systematic mutagenesis to identify critical residues for channel function

  • System integration studies:

    • Reconstitution of the complete trans-envelope assembly system

    • Investigation of temporal coordination between assembly components

    • Examination of host factors that influence pIV function

  • Comparative biology approaches:

    • Detailed comparison of pIV across diverse filamentous phages

    • Evolution of channel proteins in different phage-host systems

    • Relationship between phage channels and bacterial secretion systems

These research directions would significantly advance our understanding of how pIV functions in the context of phage biology and potentially lead to novel biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.