Recombinant Enterobacteria phage IKe Attachment protein G3P (III)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Phage Biology

As a minor coat protein, G3P (III) enables critical lifecycle functions:

Adsorption Mechanisms

  • Binds F-pilus via N-terminal domain with 17.4% homology to Enterobacteria phage f1

  • Secondary interaction with TolA domain III (host membrane protein)

Virion Assembly

Interaction PartnerFunction
pVI (G6P)Forms capsid termination complex
pVIII (G8P)Stabilizes helical capsid structure
Host TolAMediates membrane penetration

Evolutionary Conservation
Shares homology with:

  • Pseudomonas phage Pf1 (16.1% identity)

  • Xanthomonas phage ΦLf (15.9% identity)

  • Vibrio cholerae CTX phage Ace protein

Recombinant Production Protocols

Commercial production employs multiple systems:

Expression Optimization

ParameterSpecification
Codon OptimizationEnhanced for E. coli expression
SolubilityRequires Tris/PBS buffer (pH 8.0) with 50% glycerol
YieldTypical yields: 0.1–1.0 mg/mL post-purification

Quality Control

  • Endotoxin levels: Not detected (manufacturer-tested)

  • Activity validation: SDS-PAGE and Western blot

Research Applications

While direct therapeutic uses remain exploratory, current applications include:

  • Phage-host interaction studies: Mapping adsorption kinetics using surface plasmon resonance

  • Structural biology: Cryo-EM studies of virion assembly

  • Antimicrobial development: Engineering phage-derived binding domains

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-434
Protein Length
Full Length of Mature Protein
Species
Enterobacteria phage IKe (Bacteriophage IKe)
Target Names
III
Target Protein Sequence
DNWESITKSYYTGFAISKTVESKDKDGKPVRKEVITQADLTTACNDAKASAQNVFNQIKL TLSGTWPNSQFRLVTGDTCVYNGSPGEKTESWSIRAQVEGDIQRSVPDEEPSEQTPEEIC EAKPPIDGVFNNVFKGDEGGFYINYNGCEYEATGVTVCQNDGTVCSSSAWKPTGYVPESG EPSSSPLKDGDTGGTGEGGSDTGGDTGGGDTGGGSTGGDTGGSSGGGSSGGGSSGGSTGK SLTKEDVTAAIHVASPSIGDAVKDSLTEDNDQYDNQKKADEQSAKASASVSDAISDGMRG VGNFVDDFGGESSQYGTGNSEMDLSVSLAKGQLGIDREGHGSAWESFLNDGALRPSIPTG HGCTNFVMYQGSVYQIEIGCDKLNDIKSVLSWVMYCLTFWYVFQSVTSLLRKGEQ
Uniprot No.

Target Background

Function
Recombinant Enterobacteria phage IKe Attachment protein G3P (III) plays crucial roles in both viral genome penetration into the bacterial host via pilus retraction and virion extrusion. During infection initiation, G3P mediates phage adsorption to the F-pilus tip. Subsequent interaction with the host entry receptor TolA facilitates viral DNA entry into the host cytoplasm. In extrusion, G3P's C-terminal domain mediates release of the membrane-anchored virion from the cell.
Gene References Into Functions
  1. Structural analysis via X-ray crystallography and NMR spectroscopy revealed a unique fold for the N-pilus-binding domain and a conserved fold for the TolA-binding domain. PMID: 22591114
Database Links

KEGG: vg:1260884

Protein Families
Inovirus G3P protein family
Subcellular Location
Virion. Host membrane; Single-pass type I membrane protein. Note=Prior to assembly, G3P is found associated with the bacterial host inner membrane. There are about five copies of this protein per mature phage that are located on the head side of the filamentous virion.

Q&A

What is the G3P (III) protein in Enterobacteria phage IKe?

G3P (III), also known as pIII, is an attachment protein found in filamentous bacteriophages including Enterobacteria phage IKe. It plays essential roles in both the entry of the viral genome into the bacterial host and in the release from the host membrane, as well as forming the pIII-pVI virion cap . Functionally, G3P mediates adsorption of the phage to its primary receptor (N or I pili in the case of IKe) during infection initiation and to the secondary receptor (domain III of TolA protein) for subsequent infection steps . Additionally, it mediates the release of the membrane-anchored virion from the cell via its C-terminal domain . Unlike the fd phage which infects E. coli with F pili, the IKe phage specifically targets E. coli containing N or I pili .

How does the structure of G3P relate to its function in phage IKe?

The structure of G3P consists of multiple domains with distinct roles in the infection process. Crystallographic studies of related phage G3P proteins reveal that the N-terminal domains adopt a horseshoe shape with each domain consisting of either five or eight β-strands and a single α-helix . These domains engage in extensive interactions, with aliphatic amino acids and threonines lining the inside of the horseshoe, which likely constitutes the binding site for bacterial pili . A critical feature is the glycine-rich linker connecting the domains, which is often flexible in crystal structures, suggesting it provides the necessary flexibility for conformational changes during the infection process . This structural arrangement facilitates the sequential binding events where G3P first interacts with bacterial pili and then undergoes conformational changes to engage with secondary receptors like TolA to initiate genome entry .

What are the key differences between G3P in phage IKe versus phage fd?

FeatureIKe G3Pfd G3P
Receptor specificityBinds N or I piliBinds F pili
Sequence identityReference17.4% identity to IKe
Host rangeE. coli with N/I piliE. coli with F pili
Fusion capabilityCan expand host range when fused to other G3PsHost range can be expanded with IKe domains

What are the optimal conditions for expressing recombinant G3P (III) from phage IKe?

For optimal expression of functional recombinant G3P (III) from phage IKe, researchers should consider the following methodological approaches:

  • Expression system selection:

    • E. coli BL21(DE3) or similar strains with reduced protease activity are preferred

    • For improved disulfide bond formation, specialized strains like Origami™ or SHuffle® may yield better results

  • Expression conditions:

    • Lower temperatures (16-25°C rather than 37°C) promote proper folding

    • IPTG induction at OD600 0.6-0.8 with concentrations between 0.1-0.5 mM

    • Extended expression times (overnight at 16°C) often yield better-folded protein

  • Media composition:

    • Rich media like Terrific Broth supplemented with 0.5-1% glucose

    • Addition of 5-10% glycerol can enhance protein stability

    • 2-5 mM MgSO4 may improve folding of complex multi-domain proteins

  • Vector design considerations:

    • C-terminal tags are generally preferred over N-terminal tags to preserve receptor binding function

    • Inclusion of the native signal sequence for periplasmic expression can improve disulfide bond formation

    • Codon optimization for E. coli expression may improve yields

These conditions can be systematically optimized using small-scale expression trials before proceeding to larger production scales for purification and functional characterization.

How can I purify recombinant G3P (III) protein while maintaining its functional activity?

Purification of functional G3P (III) requires careful consideration of its multi-domain structure and potential sensitivity to extreme conditions:

  • Initial capture:

    • Affinity chromatography (Ni-NTA for His-tagged constructs) under mild conditions

    • Buffer: 50 mM Tris-HCl pH 7.5-8.0, 300-500 mM NaCl, 10% glycerol

    • Low imidazole (10-20 mM) in wash buffers to reduce non-specific binding

    • Elution with gradient or step-wise increase to 250-300 mM imidazole

  • Intermediate processing:

    • Immediate dialysis against stabilizing buffer (20-50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, 1 mM DTT)

    • Tag removal with site-specific proteases if necessary (while monitoring activity)

    • Buffer exchange to remove imidazole which can destabilize the protein

  • Polishing steps:

    • Size exclusion chromatography to separate properly folded monomeric protein from aggregates

    • Ion exchange chromatography can provide additional purity if required

  • Storage considerations:

    • Maintain at 4°C for short-term storage

    • For long-term storage, flash-freeze small aliquots in liquid nitrogen

    • Addition of stabilizers (10% glycerol, 0.1% pluronic F-68) may preserve activity during freeze-thaw cycles

Throughout purification, functional verification through pili-binding assays should be performed to confirm that the protein maintains its native conformation and activity .

What expression systems are most suitable for producing functional recombinant G3P (III)?

Multiple expression systems can be considered for producing functional recombinant G3P (III), each offering distinct advantages:

Expression SystemAdvantagesLimitationsBest Applications
E. coli BL21(DE3)High yield, economical, rapid expressionPotential improper folding of complex domainsInitial screening, structural studies
E. coli SHuffleEnhanced disulfide bond formation in cytoplasmLower yield than standard strainsFunctional studies requiring native disulfide bonds
E. coli periplasmic expressionNative-like oxidizing environment for disulfide formationLower yield, extraction challengesHigh-quality preparation for binding studies
Cell-free E. coli systemsRapid screening, open system for additivesHigher cost, lower scalabilityMutagenesis analysis, incorporation of non-standard amino acids
Insect cell/baculovirusBetter folding for complex domainsHigher cost, longer production timeDifficult-to-express constructs, structural biology

How can phage IKe G3P (III) be engineered to alter host specificity?

Engineering G3P (III) to alter host specificity can be achieved through several methodological approaches:

  • Domain swapping: Replace the receptor-binding domain of IKe G3P with corresponding domains from other phages targeting different receptors. This approach has been successfully demonstrated with fd phage, where fusion of the receptor-binding domain of IKe's G3P to fd's G3P expanded the host range to include E. coli containing N or I pili .

  • Directed evolution: Generate libraries of G3P variants through error-prone PCR or DNA shuffling, followed by selection for binding to desired bacterial receptors. This method explores sequence space more broadly than rational design and can reveal unexpected solutions.

  • Rational design: Using structural data, identify and modify key residues in the receptor-binding pocket through site-directed mutagenesis. Crystal structure analysis reveals a horseshoe-shaped binding interface where specific mutations can alter receptor preference .

  • Combinatorial approaches: Combine aspects of rational design and directed evolution by creating focused libraries where specific binding site residues are randomized.

Experimental validation requires a multi-step process:

  • Initial screening with purified receptor components

  • Binding assays with intact bacterial cells

  • Phage infectivity assays with engineered G3P incorporated into complete phage particles

  • Competition assays to assess relative binding affinity

These approaches have applications in expanding phage therapy targets and creating enhanced diagnostic tools for bacterial detection .

What structural modifications to G3P (III) affect its binding affinity to bacterial receptors?

Several structural modifications to G3P (III) can significantly impact its binding affinity to bacterial receptors:

These modifications are typically assessed using surface plasmon resonance (SPR) to measure binding kinetics, followed by functional infection assays to correlate binding parameters with biological activity.

How do post-translational modifications affect G3P (III) function in experimental settings?

When working with recombinant G3P (III), researchers should consider several post-translational modifications that can affect function:

  • Disulfide bond formation: Correct formation of disulfide bonds is critical for G3P (III) structural integrity. The crystal structure of related G3P proteins demonstrates the importance of these bonds in maintaining domain structure . Improper oxidative environments during expression can lead to non-native disulfide patterns that significantly impair function.

  • Proteolytic processing: Unexpected proteolytic cleavage during expression or purification can remove critical domains. Protease inhibitor cocktails during purification and careful storage optimization are essential to prevent degradation.

  • N-terminal modifications: When expressing G3P (III) with N-terminal tags, retention of the initial methionine or incomplete tag removal can sterically hinder receptor binding functions, as the N-terminal domains are critical for initial pili recognition .

  • Aggregation states: Partially misfolded G3P (III) can form soluble aggregates that appear properly purified but lack function. These can be identified through size exclusion chromatography coupled with multi-angle light scattering.

To address these challenges, researchers should:

  • Optimize oxidative folding conditions

  • Consider periplasmic expression systems for proper disulfide formation

  • Design constructs with removable tags positioned to minimize functional interference

  • Implement rigorous quality control using multiple biophysical techniques to assess proper folding

Why might recombinant G3P (III) show reduced activity compared to native protein?

Recombinant G3P (III) may exhibit reduced activity compared to native protein for several methodological reasons:

  • Improper folding: The multi-domain structure of G3P (III) requires precise folding. Crystal structure analysis reveals a complex arrangement where each domain consists of β-strands and a single α-helix engaging in extensive interactions . Expression conditions that don't support proper folding often yield protein with compromised structural integrity.

  • Incorrect disulfide bond formation: The crystal structure demonstrates the importance of proper disulfide bonding in maintaining domain structure . Bacterial cytoplasmic expression environments are typically reducing and may not support correct disulfide formation.

  • Tag interference: Purification tags, especially at the N-terminus, can sterically hinder the horseshoe-shaped binding interface identified in crystal structures . C-terminal tags are generally preferred, though they too may affect C-terminal domain functions.

  • Loss of domain flexibility: The glycine-rich linker connecting domains provides necessary flexibility during conformational changes required for receptor binding . Recombinant expression might alter this flexibility through improper folding or modification.

  • Buffer incompatibility: G3P functions in the context of the phage particle and bacterial membrane. Purification buffers may not adequately mimic this environment, particularly regarding salt concentration and pH.

To address these issues, researchers should optimize expression conditions (lower temperature, slower induction), consider periplasmic expression or specialized strains for proper disulfide formation, and test multiple buffer conditions for activity assessment.

What are the common pitfalls when working with recombinant G3P (III) in binding studies?

Researchers frequently encounter several methodological challenges when conducting binding studies with recombinant G3P (III):

  • Aggregation and non-specific binding: G3P (III) has hydrophobic regions that can promote aggregation and non-specific binding, particularly from the aliphatic amino acids that line the inside of the horseshoe-shaped binding interface . This leads to artificially high background signals in binding assays.

  • Orientation constraints in immobilization: When immobilizing G3P for binding studies, random attachment can obscure the binding interface. Crystal structure analysis reveals that the horseshoe-shaped binding region must be properly exposed for receptor interaction .

  • Avidity effects: Native G3P functions in the context of the phage particle. Single-molecule recombinant G3P studies may show different kinetics compared to whole phage particles due to avidity differences.

  • Buffer-dependent conformational changes: G3P undergoes conformational changes during infection. The flexible glycine-rich linker connecting domains is often invisible in crystal structures despite the otherwise highly ordered structure, indicating significant flexibility . Buffer conditions can lock the protein in specific conformational states.

  • Receptor preparation quality: Purified pili or membrane proteins used as binding partners must maintain native conformation, which is technically challenging.

Methodological solutions include:

  • Adding low concentrations of non-ionic detergents (0.01-0.05% Tween-20) and carrier proteins (0.1% BSA)

  • Implementing site-specific immobilization strategies

  • Including appropriate controls such as binding-deficient mutants

  • Using multiple complementary techniques (SPR, ITC, BLI) to verify binding parameters

How can I verify the correct folding of recombinant G3P (III) protein?

Verifying correct folding of recombinant G3P (III) requires a multi-technique approach:

  • Circular dichroism (CD) spectroscopy: This technique provides information about secondary structure content. G3P (III) should show a CD spectrum consistent with its β-sheet-rich structure as revealed by crystallographic studies . Thermal denaturation monitored by CD can also reveal stability characteristics and potential multiple domain unfolding transitions.

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS): This approach confirms the monomeric state of the protein and can detect partial aggregation that might indicate folding issues. The expected elution profile should correspond to the known molecular weight of G3P.

  • Limited proteolysis: Properly folded G3P (III) will show characteristic resistance to proteolytic digestion, with cleavage occurring primarily at the flexible glycine-rich linker connecting domains as identified in crystal structures .

  • Functional binding assays: The most definitive test remains biological activity. Binding assays using purified bacterial pili or whole cells expressing the appropriate receptors provide direct evidence of functional folding.

  • Thermal shift assays (Differential Scanning Fluorimetry): This technique measures protein thermal stability using environmentally sensitive fluorescent dyes. Well-folded G3P (III) will show cooperative unfolding transitions at temperatures consistent with functional protein.

  • Structural analysis by small-angle X-ray scattering (SAXS): For advanced verification, SAXS can provide low-resolution structural information to confirm that the recombinant protein adopts the expected horseshoe shape observed in crystal structures .

How does G3P (III) from phage IKe compare to attachment proteins in other filamentous phages?

G3P (III) from phage IKe shares functional similarities with attachment proteins from other filamentous phages, but with notable structural and sequence differences:

PhageG3P Identity to IKePrimary ReceptorKey Structural/Functional Differences
fd/M13/f117.4%F pilusUses F pili instead of N/I pili; similar horseshoe-shaped N-terminal domains
Pf116.1%Type IV piliAdapted to Pseudomonas host; different C-terminal organization
Pf314.6%Cell envelopeUses distinct cell envelope receptor; divergent N-terminal domain
Pf417.1%Type IV piliPseudomonas-specific; role in biofilm formation
ΦLf15.9%UnknownXanthomonas-specific; divergent binding mechanism
Rsm112.4%UnknownLowest sequence conservation; Ralstonia-specific

Despite limited sequence identity, these proteins share a common ancestry and core structural elements. All function in phage attachment, host recognition, and genome entry, though they've evolved specificity for different bacterial receptors. The N-terminal domains typically maintain the characteristic horseshoe shape with conserved structural elements, while sequence divergence reflects adaptation to different bacterial receptors .

What can we learn from comparing the crystal structures of different phage attachment proteins?

Comparative analysis of crystal structures from different phage attachment proteins reveals important insights for researchers:

These structural comparisons provide valuable insights for protein engineering efforts, particularly in phage display and targeted phage therapy applications where modifying receptor specificity is desired.

How conserved is G3P (III) across different Enterobacteria phages?

G3P (III) shows varying degrees of conservation across Enterobacteria phages, with patterns that reflect both functional constraints and host adaptation:

DomainConservation LevelFunctional Significance
N-terminal (N1)Low to Moderate (15-25%)Highest variability; determines receptor specificity
Middle (N2)Moderate (25-40%)Involved in TolA binding; more conserved than N1
C-terminalHigh (40-60%)Most conserved; essential for phage assembly and virion formation
Glycine-rich linkerModerateVariable length but conserved glycine content, provides necessary flexibility
TolA binding siteHighFunctional constraint preserves key residues for secondary receptor binding

Sequence analysis reveals that G3P (III) evolves in a domain-specific manner, with the N-terminal domains experiencing diversifying selection pressure as phages adapt to different bacterial receptors. In contrast, the C-terminal domain shows negative selection pressure, reflecting its essential role in phage assembly that cannot tolerate extensive modifications .

The formation of the G3P-G6P complex is essential for correct termination of filamentous phage assembly and formation of the pIII-pVI virion cap across different phage species, indicating strong conservation of this functional interaction . This modular evolution pattern supports engineering strategies based on domain swapping to alter host specificity, as demonstrated in experiments fusing receptor-binding domains between phages .

How is G3P (III) being utilized in phage display technologies?

G3P (III) forms the foundation of phage display technology due to its unique structural features and positioning on the phage particle:

  • Library display platforms: The N-terminus of G3P (III) can tolerate fusion with peptides or proteins while maintaining phage infectivity. This has been exploited to create libraries with diversities exceeding 10^10 unique sequences for antibody discovery and protein engineering. The crystal structure reveals that the N-terminal domains have a distinct arrangement with a horseshoe shape that can accommodate fusions while maintaining function .

  • Receptor binding engineering: Fusion of the receptor-binding domain of IKe G3P to the N-terminus of fd pIII expanded the host range of fd phage to include E. coli containing N or I pili . This principle has been extended to create phage with novel targeting capabilities for various applications.

  • Domain-swapping strategies: The structural understanding of G3P domains facilitates rational design of chimeric proteins combining domains from different phages to create novel binding specificities. For instance, swapping receptor-binding domains between phages can shift host range, as demonstrated with modifications allowing an E. coli phage to infect Klebsiella bacteria .

  • Structure-guided display optimization: The crystal structure information about the N-terminal domains of G3P guides the design of optimal fusion points and linkers to maximize display efficiency while maintaining protein folding and phage infectivity.

  • Constrained peptide libraries: The structural stability of the G3P scaffold allows for the display of constrained peptides that maintain defined structural elements, expanding the structural diversity accessible through phage display.

Recent applications include the development of therapeutic antibodies, peptide drugs, and diagnostic reagents using G3P-based phage display platforms.

What are the recent advances in engineering G3P (III) for targeted phage therapy?

Engineering G3P (III) represents a frontier in developing targeted phage therapy approaches with several methodological advances:

  • Host range expansion: Researchers have successfully engineered G3P (III) to recognize receptors on pathogenic bacteria by swapping receptor-binding domains. This approach is exemplified by fusing the receptor-binding domain of IKe G3P to the fd pIII to expand its host range .

  • Antibiotic synergy exploitation: G3P (III) has been engineered to target specific receptors involved in antibiotic resistance mechanisms. This approach was demonstrated with the OMKO1 phage which uses the outer membrane porin M (OprM) as a receptor in P. aeruginosa. Infection leads to selection of OprM mutations that affect its efflux function and restore antibiotic sensitivity .

  • Phage-antibiotic synergy: Studies have found that combination treatment using phage and sub-lethal concentrations of certain antibiotics increases host bacterial production of phages. For example, the production of phage ΦMFP in uropathogenic E. coli increased more than sevenfold when cefotaxime was added to the medium .

  • Biofilm degradation enhancement: G3P has been modified to display enzymes that can degrade biofilm matrices. For instance, T7 phage engineered to express the DspB gene from Actinobacillus actinomycetemcomitans showed significantly enhanced biofilm reduction compared to wild-type phage .

  • Precision targeting through CRISPR delivery: Phages have been engineered to deliver CRISPR-Cas systems programmed to target specific genes like antibiotic resistance determinants. When S. aureus cells carrying a kanamycin resistance gene were infected with phage packaging a CRISPR-Cas system targeting the resistance gene, strong growth inhibition was observed .

These approaches demonstrate the versatility of engineered G3P for creating next-generation phage therapeutics with enhanced specificity and efficacy.

How might structural studies of G3P (III) inform vaccine development strategies?

Structural studies of G3P (III) provide valuable insights for vaccine development strategies:

  • Epitope presentation platforms: The crystal structure of the N-terminal domains of G3P reveals a stable scaffold with a characteristic horseshoe shape . This knowledge guides the design of stable, exposed regions that can serve as epitope scaffolds. Foreign antigens can be inserted at specific positions informed by the crystal structure to maintain their native conformation while being efficiently displayed.

  • Structure-based immunogen design: Understanding the conformational flexibility of G3P domains, particularly the glycine-rich linker connecting domains that provides essential flexibility , informs the design of immunogens that can present epitopes in various conformations to elicit broadly neutralizing antibodies.

  • Phage display for epitope mapping: The structural understanding of how peptides can be displayed on G3P allows for the creation of epitope libraries to identify critical binding sites for antibodies. This facilitates reverse vaccinology approaches where protective epitopes are identified and then incorporated into vaccine designs.

  • Multivalent antigen presentation: The regular arrangement of G3P on filamentous phage particles creates opportunities for multivalent antigen display, potentially enhancing immune responses through increased avidity.

  • Immune modulation: Filamentous phages displaying engineered G3P can themselves function as immune-modulating particles, potentially providing adjuvant effects through pattern recognition receptor activation.

The application of these structural insights has led to experimental vaccine candidates against various pathogens, with the phage particles serving as both antigen carriers and immune stimulants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.