Recombinant Enterobacteria phage IKe Gene 1 protein (I)

What is the function of Gene 1 protein (pI) in Enterobacteria phage IKe?

Gene 1 protein (pI) in Enterobacteria phage IKe serves as a critical component in phage morphogenesis and assembly. It functions as an inner membrane component of the trans-envelope assembly/secretion system and interacts with pIV (G4P) during the phage assembly process . The protein is essential for the proper assembly of the phage particle as it emerges from the bacterial host. While sharing functional similarity with its homologs in other filamentous phages, IKe pI exhibits only 50.1% sequence identity with Enterobacteria phage f1 pI, suggesting potential structural or mechanistic differences in how it performs its assembly function .

How does Enterobacteria phage IKe Gene 1 protein compare structurally to homologous proteins in other phages?

Enterobacteria phage IKe Gene 1 protein shares varying degrees of homology with similar proteins in other phages and bacterial systems:

The protein consists of 365 amino acids with a sequence: MAVYVVTGKLGAGKTLVAVSRIQRTLAKGGIVATNLNLKLHHFPQVGRYAKQCRVMRIADKPTLEDLESIGRGNLTYDESKNGLLVLDECGTWFNSRNWSDKSRQPVIDWCLHARKLGWDIIFIIQDISLMDKQARDALAEHVVYCRRLDKLNIPIIGGLISVLSGGRLPLPKVHFGIVKYGDNPQSLTVDKWVYTGTDLYAAYDTKQIFTSDREISPPYCPLSPYYTHGIFSVKRDAKYMRMTKIYFKKMNRVFLMASFLALGAACGIFYKSQAYSNQLQHIQDNSKTSVISKTDQSAEILPRLSINSYSQMGYDVSVTFKDAKAKIYNSFDLIKDGYRVDIKDACHVTIVKKSYIQQI .

What expression systems are commonly used for producing recombinant Enterobacteria phage IKe Gene 1 protein?

Recombinant Enterobacteria phage IKe Gene 1 protein is typically expressed in E. coli expression systems. Commercial preparations of this protein employ the full-length protein (amino acids 1-365) with His-tag modifications to facilitate purification . The expression system must account for the membrane-associated nature of pI, which presents challenges for soluble protein production.

For research purposes, the protein is often supplied in a Tris-based buffer with 50% glycerol optimized for protein stability . Storage recommendations include keeping the protein at -20°C for standard storage or -80°C for extended storage, with working aliquots maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles that could compromise functionality .

How can homologous recombination techniques be applied to study or modify Gene 1 protein function in phage IKe?

Homologous recombination techniques offer powerful approaches for studying and modifying Gene 1 protein function in phage IKe. One applicable method is Bacteriophage Recombineering of Electroporated DNA (BRED), which exploits phage-encoded recombination systems such as the Red system of phage lambda or the RecE/RecT system of Rac prophage .

For studying Gene 1 protein specifically:

• Design homologous DNA fragments containing your desired mutation, deletion, or insertion in the gene I sequence, flanked by 100-500 bp homology arms matching the adjacent phage genome regions.

• Co-transform the donor DNA with phage IKe DNA into bacteria expressing recombination proteins (often from plasmids carrying the recombination genes).

• Allow infection cycles to proceed, which will generate mixed plaques containing both wild-type and recombinant phages.

• Screen resultant plaques using PCR or sequencing to identify those containing the desired modification.

• Perform plaque purification to isolate homogeneous populations of the engineered phage.

This technique can achieve recombination efficiencies of 3.4-22.2% in initial screens , though subsequent purification steps are necessary. For bacteria with low transformation efficiencies, an alternative approach involves transforming only the donor DNA into bacteria already containing the recombination system, followed by infection with wild-type phage IKe .

What experimental approaches can resolve the apparent contradictions in translation efficiency between genes V and VII in IKe phage?

The significant difference in translation efficiency between genes V and VII in IKe phage (approximately 75-fold reduction from gene V to gene VII) presents an intriguing research question . To investigate this phenomenon, several experimental approaches can be employed:

• Construct gene fusion reporters: Create lacZ fusions with gene V and gene VII initiation sites to quantitatively measure their intrinsic translation activities in isolation and in their natural genomic context.

• Mutational analysis: Systematically introduce mutations in the intergenic region between genes V and VII to identify sequence elements responsible for the dramatic drop in translation.

• Ribosome profiling: Apply ribosome profiling techniques to map the exact positions and densities of ribosomes on the phage mRNA during infection to identify potential stalling or drop-off sites.

• RNA structure analysis: Investigate mRNA secondary structures using SHAPE (Selective 2′-hydroxyl acylation analyzed by primer extension) or similar techniques to determine if structural elements influence ribosome access to the gene VII start site.

• Trans-acting factors: Screen for host or phage-encoded factors that might regulate this differential translation by performing pull-down assays coupled with mass spectrometry.

Research suggests that unlike the Ff phage gene VII (which has an initiation site with no detectable intrinsic activity but is coupled to upstream translation), the IKe gene VII initiation site has detectable activity but is only marginally coupled to upstream translation . The severe drop in translation efficiency (75-fold versus 10-fold in Ff phages) suggests that IKe has evolved a distinct mechanism for regulating gene VII expression.

How does the function of Gene 1 protein in IKe phage assembly compare with its potential role in bacterial secretion systems?

Gene 1 protein (pI) shares homology with bacterial secretion system components, particularly with the Zot toxin of Vibrio cholerae (15.5% identity) and Zot-like proteins in Pseudomonas phage Pf4 (13.6% identity) . This homology suggests evolutionary relationships between phage assembly mechanisms and bacterial secretion systems that can be investigated through several experimental approaches:

• Domain swapping experiments: Create chimeric proteins containing domains from IKe pI and bacterial secretion system components to determine functional conservation.

• Interaction partner identification: Use co-immunoprecipitation and mass spectrometry to identify host bacterial proteins that interact with pI during phage assembly, then compare these with known components of bacterial secretion systems.

• Cross-complementation studies: Test whether expression of Gene 1 protein can complement defects in bacterial secretion system mutants, or vice versa.

• Structural analysis: Solve the structure of Gene 1 protein and compare it with known structures of bacterial secretion system components.

• Electron microscopy: Visualize the assembly process using cryo-electron microscopy to determine the similarities and differences between phage assembly and bacterial secretion mechanisms.

The phage assembly system involving pI and pIV creates a trans-envelope channel similar to certain bacterial secretion systems, suggesting potential evolutionary relationships or convergent solutions to the challenge of transporting macromolecules across bacterial membranes.

What are the optimal conditions for maintaining activity of purified recombinant Enterobacteria phage IKe Gene 1 protein?

Maintaining the activity of purified recombinant Enterobacteria phage IKe Gene 1 protein requires careful attention to storage and handling conditions:

• Storage buffer composition: The protein shows optimal stability in Tris-based buffer with 50% glycerol specifically optimized for this protein .

• Temperature conditions:

  • Long-term storage: -20°C or -80°C for extended periods

  • Working aliquots: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce activity

• Protein concentration: Maintaining appropriate protein concentration is critical; protein-specific dilution buffers should be used rather than water to prevent denaturation.

• Metal ion considerations: Since Gene 1 protein may require specific metal ions for its structural integrity or function, buffers should be tested with various divalent cations (Mg²⁺, Ca²⁺) to determine optimal conditions.

• Detergent requirements: As a membrane-associated protein, the addition of mild detergents (0.01-0.05% non-ionic detergents like Triton X-100) may help maintain proper folding and activity.

Assessment of protein activity can be performed through functional assays that measure the protein's ability to interact with its known binding partners, particularly pIV (G4P).

What techniques are most effective for analyzing the interaction between Gene 1 protein (pI) and Gene 4 protein (pIV) in the phage assembly process?

Analyzing the critical interaction between Gene 1 protein (pI) and Gene 4 protein (pIV) in phage assembly requires methods that can detect and characterize membrane protein interactions. The most effective techniques include:

• Bacterial two-hybrid system: Adapted for membrane proteins, this technique can detect interactions between pI and pIV in their native membrane environment.

• Co-immunoprecipitation (Co-IP): Using antibodies against either pI or pIV to pull down protein complexes, followed by Western blotting to detect the interacting partner.

• Biolayer interferometry (BLI) or surface plasmon resonance (SPR): These label-free techniques can measure binding kinetics and affinity between the purified proteins when one is immobilized on a sensor.

• Fluorescence resonance energy transfer (FRET): By tagging pI and pIV with appropriate fluorescent proteins, their interaction can be monitored in real-time during phage assembly.

• Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify specific regions of interaction between the two proteins.

• Cryo-electron microscopy: This technique can visualize the entire assembly complex, providing structural insights into how pI and pIV interact during phage assembly.

• Split GFP complementation: Fusing complementary fragments of GFP to pI and pIV can generate fluorescence signals when the proteins interact, allowing visualization in live cells.

These approaches can help elucidate how the trans-envelope assembly/secretion system composed of pI and pIV functions during phage assembly and emergence from the bacterial host.

How can CRISPR-Cas systems be applied to study or modify Gene 1 protein function in phage IKe?

CRISPR-Cas systems offer powerful approaches for studying and modifying Gene 1 protein function in phage IKe through several strategies:

• Direct genome editing of phage IKe:

  • Design gRNAs targeting specific regions of gene I

  • Introduce Cas9 or Cas12a along with appropriate repair templates containing desired mutations

  • Screen resulting phages for successful edits

• Creation of bacterial CRISPR immunity against specific gene I variants:

  • Generate bacterial strains with CRISPR systems targeting specific gene I sequences

  • Use these strains for selection of phage mutants with alterations in gene I

• Engineered phage with CRISPR-Cas payloads:

  • Modify gene I while simultaneously incorporating a CRISPR-Cas system into the phage genome

  • This approach can create phages with enhanced antibacterial properties similar to the SNIPR001 system

• CRISPRi for functional studies:

  • Use catalytically inactive Cas9 (dCas9) to bind to specific regions of gene I without cleaving

  • This can block transcription or translation, allowing study of partial loss-of-function phenotypes

• CRISPR-based imaging:

  • Employ fluorescently tagged dCas9 to visualize gene I DNA or RNA in real-time during infection

  • This enables tracking of gene expression dynamics throughout the phage life cycle

Researchers have successfully used CRISPR-Cas systems to engineer λ prophages to target antibiotic resistance genes in E. coli, restoring antibiotic sensitivity . Similar approaches could be adapted to study IKe gene I function by creating specific mutations or regulatory modifications.

How might the study of translation regulation between genes V and VII in phage IKe inform synthetic biology applications?

The unique translation regulation mechanism observed between genes V and VII in phage IKe, where translation drops approximately 75-fold at the gene junction , presents valuable insights for synthetic biology applications:

• Tunable gene expression systems: The natural regulatory elements from the V-VII junction could be engineered into synthetic circuits to create predictable and tunable expression ratios between adjacent genes without requiring separate promoters.

• Polycistronic expression optimization: Many synthetic biology applications require precise stoichiometric expression of multiple proteins from a single transcript. The mechanisms underlying the IKe V-VII junction could inform design principles for creating optimized polycistronic expression cassettes with predetermined expression ratios.

• Translational insulators: The regulatory elements that limit translation coupling between genes V and VII could be developed into "translational insulators" that prevent context effects when genetic parts are combined in novel ways.

• Minimal genetic switches: Understanding the molecular basis for the dramatic drop in translation efficiency could lead to the development of compact translational switches that respond to specific cellular conditions.

• Host-independent expression control: Unlike transcriptional regulation, which often depends on host-specific factors, translational control mechanisms from phages may function across diverse bacterial hosts, making them valuable for broad-host-range synthetic biology applications.

The unexpectedly severe drop in translation demonstrated by IKe (75-fold versus 10-fold in related phages) suggests the evolution of specialized regulatory mechanisms that could be particularly valuable for applications requiring tight control of gene expression.

What potential biotechnological applications exist for engineered versions of Enterobacteria phage IKe Gene 1 protein?

Engineered versions of Enterobacteria phage IKe Gene 1 protein (pI) offer several promising biotechnological applications based on its native function in phage assembly and its structural similarities to bacterial secretion system components:

• Novel secretion systems: Modified pI proteins could be developed into customized secretion systems for the targeted export of recombinant proteins, particularly those that are difficult to secrete using conventional methods.

• Phage display technology enhancement: Engineered pI variants could improve phage display systems by modifying the assembly process to accommodate larger or structurally complex protein fusions.

• Antimicrobial delivery systems: The trans-envelope channel formed by pI and pIV could be repurposed to deliver antimicrobial compounds directly into bacterial cells, potentially addressing antibiotic resistance challenges.

• Bacterial membrane protein production: The assembly system involving pI could be adapted to facilitate the expression and purification of difficult-to-produce bacterial membrane proteins.

• Vaccine development platforms: The phage assembly machinery could be engineered to create virus-like particles presenting specific antigens, building on approaches that have used phages as vaccine platforms to deliver antigens as part of virus-like nanoparticles .

• Targeted bacterial killing: Drawing inspiration from the SNIPR001 approach that combines phage engineering with CRISPR-Cas systems , modified pI could contribute to enhanced specificity in engineered phages targeting pathogenic bacteria.

Research on engineered phages with antibacterial CRISPR-Cas systems has demonstrated their ability to selectively eliminate target bacteria in biofilms and reduce the emergence of phage-tolerant strains , suggesting similar potential for IKe-based systems.

How can comparative studies between IKe and other filamentous phages inform our understanding of phage evolution and host adaptation?

Comparative studies between IKe and other filamentous phages, particularly those in the Ff group (f1, M13, and fd), provide valuable insights into phage evolution and host adaptation mechanisms:

• Evolutionary divergence analysis: Despite functional similarities, IKe shares only 55% DNA sequence identity with the Ff group , making comparative genomic studies particularly informative for understanding phage divergence rates and patterns.

• Host range determinants: Systematic comparison of the receptor binding proteins and host interaction factors between IKe and other filamentous phages can reveal the molecular determinants of host specificity and potential mechanisms for host range expansion.

• Translation regulation evolution: The distinct mechanisms of translation regulation between genes V and VII in IKe versus Ff phages (75-fold versus 10-fold reduction) suggest different evolutionary solutions to the same biological challenge, providing insights into evolutionary convergence and divergence.

• Structural adaptation: Comparative structural studies of homologous proteins, such as pI which shows varying degrees of sequence identity across different phages (from 99.7% to 13.6%) , can reveal how protein structures adapt while maintaining function.

• Methodology for evolutionary studies:

  • Construct chimeric phages with components from different filamentous phages

  • Perform experimental evolution studies under different selection pressures

  • Conduct phylogenetic analyses incorporating both sequence and functional data

  • Apply ancestral sequence reconstruction to infer the properties of evolutionary intermediates

These comparative approaches can reveal how phages adapt to their bacterial hosts through molecular evolution of their morphogenetic and replication systems, potentially informing both basic evolutionary biology and applied phage engineering efforts.

What are common challenges in working with recombinant Enterobacteria phage IKe Gene 1 protein and how can they be addressed?

Researchers working with recombinant Enterobacteria phage IKe Gene 1 protein commonly encounter several challenges that can be addressed through specific methodological approaches:

• Protein solubility issues:

  • Challenge: As a membrane-associated protein, pI often has limited solubility in aqueous buffers.

  • Solution: Include appropriate detergents (0.01-0.05% non-ionic detergents) in purification and storage buffers; consider using amphipols or nanodiscs for maintaining native-like membrane protein environments.

• Protein aggregation during storage:

  • Challenge: Membrane proteins are prone to aggregation during storage.

  • Solution: Store in 50% glycerol at -20°C or -80°C; prepare small working aliquots to avoid repeated freeze-thaw cycles; consider adding stabilizing agents like arginine or specific lipids .

• Loss of activity in functional assays:

  • Challenge: The protein may lose activity rapidly after purification.

  • Solution: Test activity immediately after purification; store working aliquots at 4°C for no more than one week; consider including cofactors necessary for function in storage buffers.

• Difficulty in detecting protein-protein interactions:

  • Challenge: The membrane-associated nature of pI complicates interaction studies.

  • Solution: Use membrane-compatible interaction assays such as split-GFP complementation or FRET; consider crosslinking approaches followed by mass spectrometry.

• Expression challenges in recombinant systems:

  • Challenge: Overexpression of membrane proteins often leads to toxicity or inclusion body formation.

  • Solution: Use tunable expression systems; lower induction temperature; co-express with chaperones; consider membrane-protein-specific expression hosts.

• Purification artifacts:

  • Challenge: Tag-based purification may affect protein function or create purification artifacts.

  • Solution: Compare different tag positions (N-terminal vs. C-terminal); include tag removal options; validate findings with differently tagged versions of the protein.

These approaches can significantly improve the success rate when working with this challenging but important phage protein.

How can researchers distinguish between phenotypes caused by gene I mutations versus polar effects on adjacent genes?

Distinguishing between phenotypes caused directly by gene I mutations versus polar effects on adjacent genes requires careful experimental design and controls:

• Complementation studies:

  • Create a separate expression construct containing only wild-type gene I

  • Express this construct in trans in strains carrying the gene I mutation

  • Complete rescue of the phenotype suggests the effect is specific to gene I

• Translational reporters:

  • Construct translational fusions of reporter genes (e.g., lacZ, GFP) to genes downstream of gene I

  • Compare expression levels in wild-type versus gene I mutant backgrounds

  • This can directly measure polar effects on downstream gene expression

• Operon structure analysis:

  • Perform RT-PCR or RNA-seq to determine if gene I mutations affect transcript levels of adjacent genes

  • Northern blotting can reveal changes in mRNA processing or stability

• Precise genetic engineering:

  • Use scarless genome editing techniques that minimize disruption to adjacent sequences

  • Create silent mutations that don't alter the amino acid sequence but may affect function through other mechanisms

  • Introduce compensatory mutations in overlapping genes to maintain their coding capacity

• Protein level analysis:

  • Perform Western blotting for proteins encoded by adjacent genes to confirm whether their levels are affected

  • Use quantitative proteomics to assess global effects on protein expression

Research on translation efficiency between IKe genes V and VII demonstrates how adjacent genes can be regulated at the translational level despite being encoded on the same mRNA , highlighting the importance of these controls when interpreting phage gene function.

What strategies can resolve reproducibility issues in assays measuring Gene 1 protein interactions with host cell components?

Reproducibility challenges in assays measuring Gene 1 protein interactions with host cell components can be addressed through several methodological strategies:

• Standardization of expression conditions:

  • Define precise growth conditions, induction parameters, and harvest timing

  • Use calibrated expression systems with tunable promoters to ensure consistent protein levels

  • Document strain backgrounds comprehensively, including any mutations affecting membrane composition

• Controlled membrane preparation:

  • Develop standardized protocols for membrane fraction isolation

  • Characterize lipid composition of prepared membranes, as this can significantly affect membrane protein interactions

  • Consider using defined artificial membrane systems (liposomes, nanodiscs) for more controlled interaction studies

• Multiplexed detection methods:

  • Employ multiple complementary techniques to verify interactions (e.g., co-IP, FRET, bacterial two-hybrid)

  • Include positive and negative controls in each experimental run

  • Develop quantitative assays rather than relying on binary (yes/no) interaction results

• Accounting for host cell variability:

  • Test interactions in multiple E. coli strains to ensure robustness

  • Consider how growth phase and cellular stress affect interaction profiles

  • Document batch effects and develop normalization strategies

• Recombinant protein quality control:

  • Implement rigorous quality control for recombinant protein preparations

  • Validate proper folding using circular dichroism or limited proteolysis

  • Ensure consistent post-translational modifications that may affect interactions

• Data reporting standards:

  • Report all experimental parameters in sufficient detail for reproduction

  • Include raw data and detailed statistical analysis

  • Use consistent quantification methods across experiments