Recombinant Enterobacteria phage IKe Head virion protein G6P (VI)

Shipped with Ice Packs
In Stock

Description

Introduction to Enterobacteria phage IKe Head virion protein G6P (VI)

The Head virion protein G6P (VI), also referred to as Coat protein D, is a minor coat protein located at the head of the Enterobacteria phage IKe viral particle. This protein is encoded by gene VI in the phage genome and performs crucial roles in maintaining phage structural integrity. The recombinant version of this protein is produced through genetic engineering techniques for research and analytical purposes. The protein is characterized by its UniProt accession number P03674 and consists of a complete amino acid sequence spanning positions 1-116 . Bacteriophages like IKe have evolved specialized protein structures that allow them to effectively infect bacterial hosts, with minor coat proteins like G6P (VI) contributing to this complex machinery.

In filamentous bacteriophages, structural proteins arrange in specific conformations to create the viral capsid that encapsulates the genomic material. The head virion protein G6P (VI) is located at one end of the phage particle, where it works in conjunction with other minor coat proteins to form the phage "head" structure. This architectural organization is critical for the phage's ability to protect its genetic material and successfully interact with host cells during infection .

Classification and Nomenclature

The Head virion protein G6P (VI) derives its name from its gene designation (gene VI) and its function as a structural component (G6P) of the phage head. The protein is found in several related filamentous bacteriophages, including the extensively studied M13 and If1 phages, which share similar structural organizations. These filamentous phages belong to the family Inoviridae and specifically infect Enterobacteria hosts. The recombinant version of this protein is produced by expressing the gene in suitable host systems, typically E. coli, often with the addition of purification tags such as histidine tags for simplified isolation .

Role in Phage Assembly and Infection

The G6P (VI) protein plays a vital role in the assembly and release of new phage particles from infected bacterial cells. During phage assembly, all capsid proteins, including G6P (VI), are initially synthesized and accumulated in the inner membrane of the host cell via transmembrane helices. The assembly process begins with the pVII-pIX complex, followed by the helical assembly of pVIII on the single-stranded DNA. The precomplex of pIII-pVI (which includes G6P) finalizes the structure and facilitates the detachment of the newly formed phage particle from the host cell envelope .

Beyond its role in assembly, research suggests that G6P (VI) may also participate in the formation of a pore during the infection process. When a phage infects a bacterial cell, the pIII C-terminal domain is believed to form a pentamer that potentially creates a pore for the phage ssDNA genome to cross the inner membrane. It has been hypothesized that G6P (VI) may assist in this pore formation, although this requires further experimental verification .

Interactions with Other Phage Proteins

G6P (VI) exhibits specific interactions with other phage proteins, most notably with the pIII protein. In the intact phage head, the five pIII C-domains are organized primarily in α-helices and maintain close contact with five units of pVI (G6P). This arrangement has been confirmed through bacterial two-hybrid approaches, which demonstrated that pIII can interact with itself as well as with pVI .

These protein-protein interactions are essential for maintaining the structural integrity of the phage particle and for facilitating the infection process. The coordinated actions of pIII and pVI enable the phage to successfully navigate the complex process of host cell infection, from initial attachment to the release of the viral genome into the bacterial cytoplasm.

Expression Systems and Purification

Recombinant G6P (VI) is typically produced in E. coli expression systems, where the gene encoding the protein is cloned into appropriate expression vectors. For enhanced purification efficiency, the protein is often fused with affinity tags, most commonly histidine tags at either the N-terminal or C-terminal end. Similar to the approach used for the related If1 phage protein, the expression system allows for the production of the full-length protein (amino acids 1-116) .

Purification of the recombinant protein generally involves affinity chromatography, leveraging the presence of the histidine tag for selective binding to metal-chelating resins. Following elution from the affinity column, the protein typically undergoes additional purification steps such as size exclusion chromatography or ion-exchange chromatography to achieve high purity, generally exceeding 90% as determined by SDS-PAGE analysis .

Applications in Research and Biotechnology

Recombinant Enterobacteria phage IKe Head virion protein G6P (VI) has several applications in research and biotechnology. These include:

Immunological Applications

As a recombinant protein, G6P (VI) can be used for the development of specific antibodies that target phage structural proteins. These antibodies find applications in research, diagnostics, and potentially in therapeutic contexts where phage detection or neutralization is desired.

Protein Engineering Platforms

The knowledge gained from studying G6P (VI) and its interactions contributes to the development of protein engineering platforms. Understanding how minor coat proteins interact with other components of the phage structure informs the design of novel protein assemblies with applications in nanobiotechnology and drug delivery systems.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
VI; Head virion protein G6P; Coat protein D; G6P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Enterobacteria phage IKe (Bacteriophage IKe)
Target Names
VI
Target Protein Sequence
MPALLGIPALIRFIMGLVPIAIGYFAKFLGMIITRNGLMASALIGAILSVVSFSIQLLGD ALSSSMGGISADFGNLMSSVLPDGTTTCITVIITTRIAVFVFDIKDRLLGIANKVI
Uniprot No.

Target Background

Function
This protein plays crucial roles in both the entry of the viral genome into the bacterial host and the budding process. The formation of the G3P-G6P complex, known as the adsorption complex, is essential for the correct termination of filamentous phage assembly.
Database Links

KEGG: vg:1260885

Protein Families
Inovirus G6P protein family
Subcellular Location
Virion. Host membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Enterobacteria phage IKe Head virion protein G6P (VI)?

Enterobacteria phage IKe Head virion protein G6P (VI) is a 112-residue, predominantly hydrophobic protein without a signal sequence. The protein is composed of three α-helices arranged in a distinctive "U" shape. The N-terminus forms the longest α-helix spanning approximately 54 residues, which transitions into a shorter 10-residue α-helix, and finally into a C-terminal α-helix of 32 residues. The C-terminus is buried in the center of the pointy tip of the phage structure . This structural arrangement contributes to the protein's role in phage assembly and stability.

What are the known functional domains within G6P (VI)?

The G6P (VI) protein contains distinct functional domains that contribute to its role in phage assembly:

  • N-terminal domain (α-helix 1): The longest helix forms the primary structural element.

  • Middle domain (α-helix 2): A short connecting helix that maintains the "U" conformation.

  • C-terminal domain (α-helix 3): Involved in interactions with other structural proteins.

What are the optimal conditions for expressing recombinant G6P (VI) protein?

Recombinant Enterobacteria phage IKe Head virion protein G6P (VI) is typically expressed in E. coli expression systems, with the protein fused to an N-terminal His tag to facilitate purification . The optimal expression conditions include:

ParameterRecommended Condition
Expression systemE. coli BL21(DE3) or similar strains
Induction methodIPTG (0.5-1.0 mM)
Temperature18-25°C for soluble expression
Duration16-18 hours
MediaLB supplemented with appropriate antibiotics

Lower temperatures during induction are recommended due to the hydrophobic nature of the protein, which may lead to inclusion body formation at higher temperatures. A gradual induction approach with lower IPTG concentrations may yield better soluble protein expression.

What purification strategies yield the highest purity for functional studies of G6P (VI)?

For high-purity G6P (VI) protein preparations suitable for functional studies, a multi-step purification strategy is recommended:

  • Initial capture: Ni-NTA affinity chromatography utilizing the His-tag

  • Intermediate purification: Ion exchange chromatography

  • Polishing step: Size exclusion chromatography

For functional studies examining interactions with other phage proteins, additional considerations include:

  • Using detergent-based buffers (e.g., containing mild detergents like DDM or LDAO) to maintain protein solubility

  • Implementing a buffer exchange step to remove imidazole following affinity purification

  • Considering on-column refolding strategies if the protein is recovered from inclusion bodies

The final product should achieve greater than 90% purity as determined by SDS-PAGE .

How should researchers handle and store purified G6P (VI) protein to maintain activity?

Proper handling and storage of purified G6P (VI) protein is critical for maintaining structural integrity and functional activity:

  • Buffer composition: Store in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • Aliquoting: Divide into single-use aliquots immediately after purification

  • Storage temperature: Store at -20°C or preferably -80°C for long-term stability

  • Freeze-thaw cycles: Avoid repeated freeze-thaw cycles as they can cause protein denaturation

  • Reconstitution: When using lyophilized protein, reconstitute to 0.1-1.0 mg/mL in deionized sterile water

  • Cryoprotectant: Add glycerol to a final concentration of 5-50% (recommended optimum is 50%) for long-term storage

Working aliquots can be stored at 4°C for up to one week to avoid repeated freezing and thawing of the protein .

How does G6P (VI) interact with other phage structural proteins?

G6P (VI) protein forms extensive interactions with other phage proteins, particularly with protein III (pIII). Five copies of the pIII-pVI protein pair are arranged symmetrically to form the pointy tip of the phage with intertwined helices from both proteins . The specific interactions include:

  • pVI-pVI interactions: Each pVI chain forms seven hydrogen bonds with neighboring pVI chains, concentrated near the C-termini

  • pVI-pIII interactions: pIII makes 12 hydrogen bonds and 1 salt bridge with its two neighboring pVI molecules

  • Charge complementarity: The outer surface of pVI is hydrophobic with two distinct rings of positive charge, while pIII forms a negatively charged scaffold around it

These interactions create a structurally stable phage tip where hydrophobic interactions are shielded at the center of the assembled phage, while the solvent-exposed outside remains negatively charged and hydrophilic .

What techniques are most effective for studying G6P (VI) oligomerization?

To effectively study G6P (VI) oligomerization and its interactions with other phage proteins, researchers should consider the following techniques:

TechniqueApplicationAdvantages
Cryo-electron microscopy (cryo-EM)Structural analysis of protein assembliesProvides high-resolution structural data of intact phage particles
Size exclusion chromatography (SEC)Analysis of oligomeric statesNon-destructive technique for determining protein complex size
Analytical ultracentrifugationDetermination of stoichiometryAccurate measurement of molecular weight and shape
Fluorescence spectroscopyEnvironmental sensing of tryptophan residuesCan detect conformational changes during oligomerization
Circular dichroism (CD)Secondary structure analysisMonitors helical content during assembly
Chemical crosslinking coupled with mass spectrometryIdentifying interaction interfacesMaps specific residues involved in protein-protein contacts

Cryo-EM has proven particularly valuable for studying the intact phage structure, revealing how G6P (VI) interacts with other proteins in the native environment .

What factors influence the assembly of G6P (VI) into functional phage structures?

Several factors influence the successful assembly of G6P (VI) into functional phage structures:

  • Hydrophobicity and charge distribution: The hydrophobic nature of pVI with specific regions of positive charge is essential for proper interaction with pIII

  • Helical conformation: The predominantly α-helical structure of G6P (VI) is crucial for assembly, as demonstrated by CD studies of wild-type and mutant virions

  • Environmental conditions: pH, ionic strength, and lipid composition can influence the conformation and assembly of phage coat proteins

  • Specific amino acid residues: Certain conserved residues play critical roles in maintaining the proper conformation and interactions

The assembly process is highly cooperative, with initial nucleation events followed by rapid extension of the phage structure. Mutations that disrupt the helical conformation or alter the charge distribution can significantly impact assembly efficiency and phage viability .

What spectroscopic methods provide the most valuable structural information about G6P (VI)?

Several spectroscopic methods have proven valuable for characterizing the structure of G6P (VI):

  • Circular Dichroism (CD): CD spectroscopy has demonstrated that G6P (VI) adopts a largely helical conformation in both wild-type and mutant virions. This technique can quantify the α-helical content and monitor structural changes under different conditions .

  • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence has been used to examine the polarity of the protein environment. Studies of related phage proteins showed that residues within one helical turn can modulate the tryptophan environment .

  • Nuclear Magnetic Resonance (NMR): NMR studies of phage coat proteins have revealed detailed structural information, including chemical shift changes that indicate conformational alterations. For example, 2D 1H-15N HSQC spectra can detect changes propagated beyond adjacent residues due to mutations .

  • Cryo-electron microscopy (cryo-EM): This technique has provided high-resolution structural data of the entire phage, revealing the arrangement of G6P (VI) within the assembled virion .

How does the secondary structure of G6P (VI) compare to other phage structural proteins?

The secondary structure of G6P (VI) features a distinctive three-helix arrangement in a "U" shape, which differs from other phage structural proteins:

ProteinSecondary StructureKey FeaturesFunction
G6P (VI)Three α-helices in "U" shapeN-terminal helix (54 residues), middle helix (10 residues), C-terminal helix (32 residues)Forms phage tip structure
pVIII (Major coat protein)Two α-helicesLargely helical conformation in virionForms the main capsid of the phage
pIIIMultiple domains with α-helicesNegatively charged scaffoldMediates phage infection
Gene V proteinβ-sheets and β-turnsFive conserved tyrosine residuesDNA binding protein

What structural features of G6P (VI) contribute to phage stability?

Several structural features of G6P (VI) contribute significantly to phage stability:

  • Helical conformation: The three α-helices provide structural rigidity and create a stable framework for the phage tip .

  • Hydrogen bonding network: Each pVI chain forms seven hydrogen bonds with neighboring pVI chains, creating a stable interconnected structure .

  • Hydrophobic core: The arrangement of pVI proteins shields hydrophobic interactions at the center of the assembled phage, preventing unfavorable interactions with the aqueous environment .

  • Charge complementarity: The positively charged rings on the outer surface of pVI interact with the negatively charged scaffold formed by pIII, stabilizing the protein-protein interfaces .

  • C-terminal burial: The C-terminus of pVI is buried in the center of the pointy tip, providing additional stability to the structure .

These features work together to create a thermodynamically stable structure that can withstand environmental stresses while maintaining the functional integrity of the phage particle.

How does G6P (VI) compare functionally to homologous proteins in other phages?

G6P (VI) belongs to a family of proteins found in filamentous phages, with both functional similarities and differences compared to homologous proteins:

What are the most sensitive detection methods for tracking G6P (VI) in experimental systems?

Several sensitive detection methods can be employed to track G6P (VI) in experimental systems:

Detection MethodSensitivityApplication
Western blotting with anti-His antibodiesNanogram rangeDetection of His-tagged G6P (VI) in complex mixtures
Fluorescence-based assaysPicogram rangeReal-time tracking of labeled protein
Mass spectrometryFemtomole rangeIdentification and quantification in complex samples
ELISAPicogram rangeQuantitative detection in solution
Immunofluorescence microscopySingle moleculeLocalization studies in host cells

For recombinant His-tagged G6P (VI), antibody-based detection methods utilizing the His-tag provide convenient and sensitive detection . For more advanced applications, fluorescently labeled proteins can be tracked in real-time during phage assembly or host interaction studies.

How can researchers effectively use site-directed mutagenesis to study G6P (VI) function?

Site-directed mutagenesis is a powerful approach for studying the structure-function relationships of G6P (VI). Based on studies of related phage proteins, researchers should consider:

  • Target selection:

    • Key residues at protein-protein interfaces, particularly those involved in hydrogen bonding with pIII

    • Hydrophobic residues that contribute to core stability

    • Charged residues in the positive rings that interact with pIII

  • Mutation strategy:

    • Conservative substitutions to maintain structural integrity while altering specific properties

    • Introduction of reporter groups (e.g., fluorescent amino acids) at minimally disruptive positions

    • Incorporation of crosslinking residues to trap transient interactions

  • Functional assessment:

    • Phage assembly efficiency

    • Thermostability measurements

    • Spectroscopic analysis of structural changes

Studies of related proteins have shown that certain mutations can have profound effects on protein function. For example, Pro 30 mutations in the related coat protein were found to be critical for viability, rendering the detergent-solubilized coat protein less thermostable and altering the polarity of the Trp 29 environment . Similarly, a Pro 30 Gly mutation exhibited numerous chemical shift changes in the 2D 1H-15N HSQC spectrum, demonstrating that effects can propagate beyond adjacent residues .

What are the current challenges in studying protein-DNA interactions involving G6P (VI) and related proteins?

Studying protein-DNA interactions involving phage proteins presents several challenges:

  • Specificity of interactions: While related phage proteins like the IKe DNA binding protein bind cooperatively and with high specificity to single-stranded DNA, characterizing the exact nature of these interactions remains challenging . Approximately four bases of DNA are covered by one monomer of protein, but the structural basis of this specificity is not fully elucidated.

  • Cooperative binding mechanisms: The cooperative nature of DNA binding by phage proteins complicates the analysis of binding kinetics and thermodynamics. Advanced techniques like single-molecule FRET or atomic force microscopy may be required to fully characterize these cooperative interactions.

  • Structural studies of protein-DNA complexes: Obtaining high-resolution structures of protein-DNA complexes is technically challenging, particularly for flexible or dynamic complexes.

  • Role of specific residues: While tyrosine residues are known to be involved in DNA binding in related proteins, with positions 27, 42, and 57 in the IKe DNA binding protein being particularly important , the specific contributions of individual residues remain an area of active research.

How do conformational changes in G6P (VI) contribute to phage assembly and function?

Conformational changes in G6P (VI) are critical for phage assembly and function:

  • Transition from monomer to assembled state: The protein must undergo conformational adjustments as it integrates into the phage structure, forming specific interactions with other pVI proteins and with pIII .

  • Environmental sensing: The conformation of phage proteins can respond to environmental conditions such as pH, ionic strength, and the presence of other phage components. For example, studies of related coat proteins showed that their conformation differs markedly between the membrane-bound assembly intermediate and the phage capsid .

  • Sequestration of hydrophobic regions: Both the membrane-bound and virion forms of phage proteins represent successful strategies to sequester hydrophobic regions away from the aqueous environment, but achieve this through different conformational states .

  • Role in phage tip formation: The specific "U"-shaped conformation of G6P (VI) is essential for forming the characteristic pointy tip of the phage, with five copies of the pIII-pVI pair arranged symmetrically .

Advanced techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or time-resolved structural methods may be valuable for capturing these conformational transitions during phage assembly.

What computational approaches are most effective for predicting interactions between G6P (VI) and other phage components?

Several computational approaches can effectively predict interactions between G6P (VI) and other phage components:

  • Molecular dynamics simulations: MD simulations can model the dynamic behavior of G6P (VI) in different environments and its interactions with other proteins. These simulations can reveal transient interactions and conformational changes that may be difficult to capture experimentally.

  • Protein-protein docking: Specialized docking algorithms can predict potential binding modes between G6P (VI) and other phage proteins, particularly pIII with which it forms extensive interactions.

  • Coevolutionary analysis: By analyzing patterns of coevolution in sequence alignments of G6P (VI) and its interaction partners across different phages, researchers can identify potentially interacting residues.

  • Structure prediction: For phage components with unknown structures, approaches like AlphaFold2 can generate predicted structures that can then be used in interaction studies.

  • Secondary structure prediction: Methods similar to the Coils 2 program that has been used to identify regions that may form helical coiled-coils in related proteins can provide insights into potential interaction domains.

These computational approaches should be integrated with experimental validation to develop a comprehensive understanding of G6P (VI) interactions within the phage structure.

What controls should be included when studying G6P (VI) structure and function?

Robust experimental design for studying G6P (VI) should include several key controls:

  • Positive controls:

    • Well-characterized related proteins (e.g., phage fd Head virion protein) with known properties

    • Synthetic peptides corresponding to specific domains of G6P (VI)

    • Previously validated functional assays demonstrating expected behavior

  • Negative controls:

    • Denatured G6P (VI) protein to confirm structure-dependent functions

    • Irrelevant proteins of similar size/charge to rule out non-specific effects

    • Buffer-only controls to establish baseline measurements

  • Mutation controls:

    • Conservative substitutions that maintain function

    • Disruptive mutations at key functional sites

    • Alanine scanning mutants to identify essential residues

  • Validation across methods:

    • Complementary structural techniques (e.g., CD, fluorescence, and NMR) to corroborate findings

    • Multiple functional assays to confirm biological relevance

    • In vitro and in vivo approaches to bridge biochemical and physiological contexts

How can researchers optimize expression systems for challenging G6P (VI) variants?

Expressing challenging G6P (VI) variants may require optimization strategies:

  • Expression host selection:

    • E. coli strains optimized for membrane or hydrophobic proteins (e.g., C41/C43)

    • Strains with reduced protease activity for unstable variants

    • Codon-optimized systems for rare codon usage

  • Fusion partners and solubility tags:

    • MBP, SUMO, or Trx fusion tags to enhance solubility

    • His-tag positioning optimization (N- vs. C-terminal)

    • Cleavable tags with site-specific proteases

  • Expression conditions:

    • Temperature optimization (typically lower temperatures: 18-25°C)

    • Inducer concentration titration

    • Extended expression times with lower inducer concentrations

    • Specialized media formulations

  • Extraction and solubilization:

    • Detergent screening for optimal solubilization

    • Mild extraction conditions to maintain structure

    • On-column refolding protocols for inclusion bodies

  • Co-expression strategies:

    • Co-expression with chaperones (GroEL/ES, DnaK)

    • Co-expression with natural binding partners (e.g., pIII)

What are the most reliable approaches for assessing the biological activity of purified G6P (VI)?

Several approaches can reliably assess the biological activity of purified G6P (VI):

  • Structural integrity assessment:

    • Circular dichroism to confirm α-helical content

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Thermal stability measurements to compare with wild-type protein

  • Protein-protein interaction assays:

    • Pull-down assays with potential binding partners (especially pIII)

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Functional complementation:

    • Phage assembly assays with G6P (VI)-deficient systems

    • In vitro reconstitution of phage tips

    • Infectivity assays with reconstructed phage particles

  • Structural visualization:

    • Negative-stain electron microscopy of assembled structures

    • Cryo-EM of reconstituted complexes

    • Fluorescence microscopy of labeled proteins during assembly

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.