Recombinant Enterobacteria phage IKe Virion export protein (IV)

What is Enterobacteria phage IKe Virion export protein (IV)?

Enterobacteria phage IKe Virion export protein (IV) is a critical structural protein encoded by bacteriophage IKe, also known as Gene 4 protein (G4P). This protein plays an essential role in the assembly and export of phage particles during the viral life cycle. It is expressed from region 31-437 of the gene IV sequence and functions as part of the virion structure . The protein has been characterized with Uniprot accession number P03667 and possesses a specific amino acid sequence that contributes to its functional properties . Recent structural studies have revealed that this protein is a key component of the filamentous bacteriophage IKe architecture, contributing to its classification as a class I filamentous phage .

How does Enterobacteria phage IKe Virion export protein (IV) differ from other phage structural proteins?

Enterobacteria phage IKe Virion export protein (IV) distinguishes itself from other phage structural proteins through several key characteristics. Unlike capsid proteins that form the head structure in tailed phages, the export protein (IV) is specific to filamentous phages like IKe. It functions in the assembly and export pathway that is characteristic of filamentous phages, which are released from host cells without lysis . Modern classification approaches using machine learning have shown that virion proteins like export protein (IV) can be distinguished from non-virion proteins with high accuracy (91.84%) based on their amino acid composition features and sequence patterns . The specific amino acid sequence of this protein, which includes motifs like "DPVNLNNAPVRSFVQWYSQKSNKAVVVNPDVKGNITVFNADVNQANIDDFFKSVLNANGF", contributes to its unique structural and functional properties .

What are the optimal storage conditions for working with Recombinant Enterobacteria phage IKe Virion export protein (IV)?

For optimal research results when working with Recombinant Enterobacteria phage IKe Virion export protein (IV), adhere to the following evidence-based storage protocol:

• Long-term storage: Maintain the protein at -20°C for standard storage, or preferably at -80°C for extended preservation .

• Working aliquots: Store at 4°C for up to one week to minimize degradation from freeze-thaw cycles .

• Buffer composition: The protein shows optimal stability in Tris-based buffer with 50% glycerol, specifically optimized for this protein's structural integrity .

• Freeze-thaw management: Repeated freezing and thawing significantly compromises protein functionality. Prepare single-use aliquots during initial thawing to preserve structural integrity .

• Sample handling: When working with the recombinant protein, maintain cold chain conditions and minimize exposure to room temperature to prevent denaturation.

The adherence to these storage guidelines is critical for maintaining the structural and functional integrity of the protein for experimental applications, particularly for structural studies and enzymatic assays.

How can machine learning approaches improve the identification and classification of phage virion proteins like IKe export protein (IV)?

This model leverages four key protein sequence coding methods as features:

The application of such computational approaches enables researchers to:

• Predict novel virion proteins from genomic data with high confidence

• Identify functional domains within proteins like export protein (IV)

• Develop targeted mutations for functional studies

• Establish evolutionary relationships between different phage virion proteins

Future refinements of these machine learning approaches could incorporate structural information from cryo-electron microscopy studies , potentially increasing classification accuracy beyond the current 91.84% benchmark.

What are the structural determinants of Enterobacteria phage IKe Virion export protein (IV) that contribute to phage assembly?

The structural determinants of Enterobacteria phage IKe Virion export protein (IV) that facilitate phage assembly involve multiple specialized domains and motifs within its 407-amino acid sequence. Recent cryo-electron microscopy studies have illuminated the three-dimensional architecture of this protein within the context of the complete filamentous phage structure .

Key structural elements include:

• N-terminal domain (amino acids 31-150): Contains the sequence "DPVNLNNAPVRSFVQWYSQKSNKAVVVNPDVKGNITVFNADVNQANIDDFFKSVLNANGF" which likely mediates initial interactions with host cell membranes during export .

• Central region (amino acids 151-300): Features the motif "VLMAGDPSGVSTPSKLPSQQTDNDDDYEDSADYVPVGDSVPVSAQPQKPLDLTVRNFKLT" that appears to participate in protein-protein interactions with other phage components .

• C-terminal domain (amino acids 301-437): Contains sequences rich in glycine and charged residues that may contribute to the flexibility required during the export process .

The precise arrangement of these domains creates a tertiary structure that enables the protein to simultaneously interact with bacterial membranes, other phage structural proteins, and the DNA being packaged. The high glycerol content (50%) in optimal storage buffers suggests the importance of maintaining hydrophobic interactions within the protein's structure .

Understanding these structural determinants provides opportunities for rational design of mutations that could alter phage assembly or create novel phage-based biotechnology applications.

How do post-translational modifications affect the function of Recombinant Enterobacteria phage IKe Virion export protein (IV)?

Post-translational modifications (PTMs) significantly impact the functional capacity of Recombinant Enterobacteria phage IKe Virion export protein (IV), though this area remains less thoroughly characterized than the primary sequence. Research indicates that several potential modification sites exist within the protein's extensive 407-amino acid sequence that may regulate its activity during phage assembly and export processes.

The amino acid sequence analysis reveals multiple potential modification sites:

• Phosphorylation sites: The sequence contains numerous serine, threonine, and tyrosine residues that could undergo phosphorylation, particularly in regions containing motifs like "STPSKLPSQQTDNDDD" which includes a serine-threonine rich region .

• Glycosylation potential: Though less common in bacteriophage proteins, certain asparagine residues in the sequence may serve as N-glycosylation sites, potentially affecting protein-protein interactions during assembly.

• Proteolytic processing: The full-length protein (amino acids 31-437) likely undergoes specific cleavage events during maturation, as suggested by the Expression Region information .

When producing recombinant versions of this protein, researchers should consider the expression system's capacity to replicate native modifications. E. coli-based expression systems, while efficient for producing the protein, may not reproduce all PTMs found in the native phage infection context.

For experimental applications, researchers should evaluate whether detected functional differences between recombinant and native proteins stem from PTM variations. Techniques like mass spectrometry could identify specific modification sites to inform more accurate recombinant protein design.

What experimental approaches are most effective for studying the export function of Recombinant Enterobacteria phage IKe Virion export protein (IV)?

The export function of Recombinant Enterobacteria phage IKe Virion export protein (IV) can be effectively studied through a multi-faceted experimental approach combining in vitro and in vivo methodologies. Based on current research practices, the following integrated strategy is recommended:

• In vitro membrane interaction assays:

  • Liposome binding assays using fluorescently labeled recombinant protein

  • Surface plasmon resonance (SPR) to quantify binding kinetics to lipid bilayers

  • Atomic force microscopy to visualize protein-membrane interactions at nanoscale resolution

• Site-directed mutagenesis studies:

  • Target key residues in the N-terminal domain (amino acids 31-150) that likely mediate membrane interactions

  • Focus on the glycine-rich regions that may confer structural flexibility during export

  • Create systematic alanine scanning mutations across the protein sequence

• Phage assembly complementation assays:

  • Transform IV-deficient phage genomes with wild-type or mutant protein IV constructs

  • Quantify phage production efficiency as a function of protein IV variants

  • Analyze the resulting phage particles using electron microscopy

• Real-time export visualization:

  • Fluorescently tag protein IV with minimal reporters (e.g., split-GFP)

  • Perform time-lapse confocal microscopy during phage infection

  • Correlate protein localization with stages of phage assembly

• Cross-linking mass spectrometry:

  • Identify interaction partners during the export process

  • Map the protein-protein interaction network involved in phage assembly

  • Characterize the temporal sequence of interactions

These methodologies should be complemented with computational approaches, such as molecular dynamics simulations based on the cryo-EM structure , to develop mechanistic models of the export process. The combination of these techniques enables a comprehensive understanding of how protein IV facilitates the export of assembled phage particles without causing host cell lysis.

What are the key considerations for optimizing the expression and purification of Recombinant Enterobacteria phage IKe Virion export protein (IV)?

Optimizing the expression and purification of Recombinant Enterobacteria phage IKe Virion export protein (IV) requires careful consideration of multiple factors to ensure high yield, proper folding, and functional integrity. Based on established protocols and the protein's characteristics, researchers should address the following key considerations:

Expression System Selection:

• E. coli BL21(DE3) typically provides good expression levels for phage proteins

• Consider specialized strains for membrane proteins (e.g., C41/C43) given protein IV's membrane association

• Evaluate codon optimization based on the full amino acid sequence for the expression region 31-437

Expression Conditions:

• Induction parameters: Lower temperatures (16-20°C) often improve folding of complex membrane-associated proteins

• Media composition: Enhanced with glycerol (0.5-1%) to promote proper folding

• Induction timing: Mid-log phase (OD600 ~0.6-0.8) typically optimal

Purification Strategy:

• Initial extraction: Carefully balance detergent concentration to solubilize membrane-associated protein IV without denaturation

• Affinity chromatography: His-tag or other affinity tags should be positioned to avoid interfering with functional domains

• Buffer optimization: Maintain Tris-based buffer with glycerol consistent with storage recommendations

Quality Control Metrics:

• SDS-PAGE and Western blotting to confirm molecular weight and identity

• Circular dichroism to verify secondary structure integrity

• Functional assays to confirm biological activity (membrane binding, oligomerization)

Storage and Stability:

• Aliquot preparation: Single-use volumes to avoid freeze-thaw cycles

• Cryoprotectant addition: 50% glycerol as indicated in standard protocols

• Flash-freezing in liquid nitrogen before -80°C storage

Table 1: Optimization Parameters for Recombinant Protein IV Expression

Implementing these considerations systematically will significantly improve the likelihood of obtaining functionally active Recombinant Enterobacteria phage IKe Virion export protein (IV) suitable for downstream structural and functional studies.

How can one design experiments to investigate the interaction between Enterobacteria phage IKe Virion export protein (IV) and host cell membranes?

Designing experiments to investigate the interaction between Enterobacteria phage IKe Virion export protein (IV) and host cell membranes requires a multidisciplinary approach combining biophysical, biochemical, and genetic methodologies. The following experimental design framework addresses this complex protein-membrane interaction:

1. Membrane Binding Characterization:

A. Fluorescence-based approaches:

• FRET analysis using labeled protein IV and membrane mimetics

• Stopped-flow kinetics to measure real-time binding dynamics

• Fluorescence anisotropy to quantify binding affinity (Kd values)

B. Biophysical measurements:

• Surface plasmon resonance (SPR) with immobilized lipid bilayers

• Isothermal titration calorimetry (ITC) to determine thermodynamic parameters

• Quartz crystal microbalance with dissipation (QCM-D) for real-time binding dynamics

2. Structural Analysis of Membrane-Bound States:

A. Cryo-electron microscopy:

• Direct visualization of protein IV associated with membrane mimetics

• 3D reconstruction of membrane-bound complexes

• Integration with existing cryo-EM data on filamentous phage structure

B. NMR studies:

• Chemical shift perturbation analysis to identify membrane-interacting residues

• Paramagnetic relaxation enhancement to determine insertion depth

• Solid-state NMR for structural analysis in membrane environment

3. Functional Domain Mapping:

A. Systematic mutagenesis:

• Alanine scanning of N-terminal region (amino acids 31-150)

• Charge reversal mutations in predicted membrane-interacting regions

• Deletion analysis of specific domains

B. Chimeric protein construction:

• Domain swapping with related phage export proteins

• Fusion with reporter proteins for tracking membrane localization

• Minimal functional domain determination

4. Host-Pathogen Interaction Studies:

A. Bacterial membrane modifications:

• Lipopolysaccharide (LPS) mutants to assess outer membrane interactions

• Phospholipid composition alterations to determine lipid specificity

• Cell envelope stress response analysis during protein IV expression

B. In vivo imaging:

• Fluorescent protein fusions for real-time localization

• Super-resolution microscopy to track protein IV during infection

• Correlative light and electron microscopy to link function with ultrastructure

5. Computational Analysis:

A. Molecular dynamics simulations:

• Protein-membrane interaction energy calculations

• Conformational changes upon membrane binding

• Prediction of membrane-binding domains based on amino acid sequence

This comprehensive experimental framework enables researchers to characterize the structural determinants, kinetic parameters, and functional consequences of Enterobacteria phage IKe Virion export protein (IV) interactions with host cell membranes, providing insights into the phage export mechanism.

How does the amino acid sequence of Enterobacteria phage IKe Virion export protein (IV) relate to its structural organization?

The amino acid sequence of Enterobacteria phage IKe Virion export protein (IV) exhibits a highly organized structure-function relationship that underpins its role in phage assembly and export. Analysis of the complete 407-amino acid sequence (residues 31-437) reveals distinct domains with specific structural and functional properties:

N-terminal Domain (residues 31-150):
This region contains the sequence "DPVNLNNAPVRSFVQWYSQKSNKAVVVNPDVKGNITVFNADVNQANIDDFFKSVLNANGF" characterized by:

• High proportion of hydrophilic residues (Asn, Gln, Ser)

• Alternating hydrophobic-hydrophilic pattern suggesting amphipathic structures

• Multiple asparagine residues that may facilitate hydrogen bonding networks

• Predicted alpha-helical segments that likely interact with membrane interfaces

Central Domain (residues 151-300):
This region includes sequences like "VLMAGDPSGVSTPSKLPSQQTDNDDDYEDSADYVPVGDSVPVSAQPQKPLDLTVRNFKLT" featuring:

• Clustered acidic residues (Asp, Glu) that create negatively charged patches

• Multiple serine and threonine residues that could serve as phosphorylation sites

• Glycine residues (G) that provide conformational flexibility at key junctions

• Proline residues that likely introduce structural kinks essential for folding

C-terminal Domain (residues 301-437):
This region contains "RVRSSDVLPLAKIFVDSNGGGDVIDYPGNNSLLVSGSAAIMNALADFITSIDVARDQVLI" with:

• Glycine-rich segments (GGGD) suggesting flexible linker regions

• Hydrophobic clusters (AAIMNAL) that may form membrane-interacting regions

• Basic residues (Arg, Lys) potentially involved in nucleic acid binding

• Conservation patterns suggesting evolutionary constraints on functional sites

The presence of multiple glycine residues throughout the sequence confers flexibility needed during the dynamic process of phage assembly and export, while the storage requirements (50% glycerol) suggest that maintaining proper hydration and preventing aggregation are critical for preserving the protein's native conformation.

What role does Enterobacteria phage IKe Virion export protein (IV) play in the assembly and maturation of bacteriophage particles?

Enterobacteria phage IKe Virion export protein (IV) serves as a multifunctional component in the sophisticated machinery of bacteriophage assembly and maturation. Through integrated structural and functional studies, researchers have elucidated several critical roles this protein performs during the phage life cycle:

1. Membrane Channel Formation:
Protein IV oligomerizes to create specialized channels in the bacterial membrane that serve as conduits for phage particle export. This channel formation is critical for filamentous phages like IKe, which are released without lysing the host cell, distinguishing them from other phage classes. The amino acid sequence containing multiple hydrophobic regions interspersed with charged residues facilitates this membrane interaction .

2. DNA Processing and Packaging:
During phage assembly, protein IV coordinates with other phage proteins to ensure proper packaging of the single-stranded DNA genome. The C-terminal region likely participates in nucleic acid interactions, guiding the DNA through the assembly process and ensuring its proper orientation during export.

3. Protein-Protein Interaction Hub:
As revealed by cryo-electron microscopy studies , protein IV serves as an interaction hub, coordinating with:

• Major coat proteins that form the filament body

• Minor coat proteins that cap the filament ends

• Other assembly proteins that don't incorporate into the final virion

4. Export Timing Regulation:
The protein contains domains that likely regulate the timing of export, ensuring that phage particles are only released after complete assembly. This temporal control involves conformational changes triggered by specific assembly checkpoints.

5. Host Cell Physiology Modulation:
During infection, protein IV may modulate host cell physiology to optimize conditions for phage production. This includes:

• Altering membrane permeability

• Potentially redirecting host resources toward phage production

• Maintaining host cell viability during continuous phage export

The detailed amino acid sequence of protein IV, with its distinct structural domains spanning residues 31-437 , underlies these diverse functions. The sequence contains motifs for membrane association, protein-protein interactions, and potentially conformational switching mechanisms that coordinate the complex process of phage assembly and export.

Understanding these roles has significant implications for phage biology and potential biotechnological applications, including phage display technologies and targeted bacterial control systems.

What structural similarities and differences exist between Enterobacteria phage IKe Virion export protein (IV) and homologous proteins in other filamentous phages?

Enterobacteria phage IKe Virion export protein (IV) shares important structural features with homologous proteins in other filamentous phages, while also exhibiting distinct characteristics that reflect its specialized function in the IKe phage system. Comparative structural analysis reveals the following similarities and differences:

Structural Similarities:

Structural Differences:

• Sequence Divergence: IKe protein IV shows significant sequence divergence from other filamentous phage export proteins, particularly in the central domain region. The amino acid sequence "VLMAGDPSGVSTPSKLPSQQTDNDDDYEDSADYVPVGD" contains unique acidic residue clusters not found in other phage export proteins .

• Size Variation: At 407 amino acids (residues 31-437) , IKe protein IV differs in size from its homologues in other phages. For comparison, the export protein of phage M13 (pIV) contains 426 amino acids, while some more distant relatives may be considerably smaller or larger.

• Host Specificity Determinants: Specific regions within IKe protein IV contain unique motifs that likely determine its interaction specificity with the particular host cell envelope components of IKe's bacterial hosts, distinguishing it from other filamentous phage export proteins.

• Oligomerization Interface: The regions mediating self-association to form the export channel complex show phage-specific variations that affect the stability and dynamics of the export apparatus.

Table 2: Comparative Features of Filamentous Phage Export Proteins

These structural similarities and differences reflect the evolutionary adaptation of filamentous phage export proteins to their specific host environments while maintaining the core functional requirements for phage assembly and export. The unique features of IKe protein IV likely contribute to its specialized role in the IKe phage life cycle and host interaction specificity.

How effective are current machine learning approaches in classifying and analyzing phage virion proteins like Enterobacteria phage IKe Virion export protein (IV)?

Current machine learning approaches have demonstrated remarkable efficacy in classifying and analyzing phage virion proteins, including specialized examples like Enterobacteria phage IKe Virion export protein (IV). The RF_phage virion model, a random forest-based classification approach, has achieved particularly impressive performance metrics in distinguishing virion from non-virion proteins.

Performance Metrics of Advanced Machine Learning Models:

The RF_phage virion model has demonstrated:

These metrics represent a significant improvement over previous classification methods and provide researchers with reliable computational tools for phage protein analysis.

Feature Engineering Approaches:

The success of these machine learning models depends largely on sophisticated feature engineering techniques that extract meaningful patterns from protein sequences. For proteins like IKe Virion export protein (IV), the following feature extraction methods have proven most effective:

• Amino Acid Composition (AAC): This approach quantifies the frequency of each amino acid in the sequence, generating a 20-dimensional feature vector. For IKe protein IV, with its distinctive amino acid distribution including glycine-rich regions, this feature provides valuable classification signals .

• Composition of k-spaced Amino Acid Pairs (CKSAAP): This more sophisticated feature engineering method captures the frequency of amino acid pairs separated by k residues, generating a 400-dimensional feature space that encodes sequence patterns. For complex proteins like IKe protein IV, this feature captures critical structural motifs that contribute to function .

The implementation of these features follows specific mathematical formulations:

For AAC:
$aac(i) = \frac{n_i}{length}$

Where n_i represents the count of the i-th amino acid, and length is the total sequence length.

For CKSAAP, the feature calculation involves more complex pattern recognition across the protein sequence, analyzing all possible pairs of amino acids separated by defined distances .

Applications to Enterobacteria phage IKe Virion export protein (IV):

When applied specifically to proteins like IKe Virion export protein (IV), these machine learning approaches offer several key advantages:

• Functional Domain Prediction: By analyzing the sequence patterns in different regions of the 407-amino acid protein (residues 31-437) , machine learning models can predict functional domains with high confidence.

• Evolutionary Relationship Mapping: Classification patterns reveal evolutionary relationships between IKe protein IV and homologous proteins in other phages, providing insights into phage evolution.

• Structure-Function Correlation: The patterns identified by these models often correlate with structural features identified through experimental methods such as cryo-electron microscopy .

Despite these successes, current machine learning approaches still face challenges when analyzing highly specialized proteins with limited training examples. Ongoing research focuses on incorporating additional structural information and developing deep learning architectures that can capture more complex sequence-structure-function relationships in phage virion proteins.

What bioinformatic tools and databases are most useful for analyzing the sequence and structure of Enterobacteria phage IKe Virion export protein (IV)?

Researchers studying Enterobacteria phage IKe Virion export protein (IV) can leverage a comprehensive suite of bioinformatic tools and databases to interrogate sequence patterns, predict structural features, and understand functional domains. The following resources represent the most valuable computational assets for analyzing this specialized phage protein:

Sequence Analysis Tools:

• UniProt Knowledge Base: Contains the authoritative entry for IKe Virion export protein (accession P03667) with manually curated annotations, functional domains, and sequence features . Essential for accessing the canonical amino acid sequence spanning residues 31-437.

• BLAST and PSI-BLAST: Critical for identifying homologous proteins across different phage families, enabling evolutionary analysis and functional inference through sequence similarity.

• Multiple Sequence Alignment (MSA) Tools:

  • MUSCLE and MAFFT: For high-accuracy alignment of IKe protein IV with homologues

  • T-Coffee: Particularly useful for detecting conserved motifs within the 407-amino acid sequence

  • Clustal Omega: Effective for phylogenetic analysis of filamentous phage export proteins

• Sequence Feature Prediction:

  • SignalP: For signal peptide prediction (particularly relevant for residues 31-50)

  • TMHMM and HMMTOP: For transmembrane domain prediction within the hydrophobic regions

  • NetPhos: For phosphorylation site prediction among the numerous serine and threonine residues

Structural Analysis Resources:

• Protein Structure Databases:

  • Protein Data Bank (PDB): Repository for experimental structures, including cryo-EM data of filamentous phages

  • Electron Microscopy Data Bank (EMDB): Contains density maps from cryo-EM studies of filamentous phages

• Structure Prediction Tools:

  • AlphaFold2: State-of-the-art deep learning approach for predicting protein structure from sequence

  • I-TASSER: Integrated platform for structure and function prediction

  • SWISS-MODEL: Homology modeling server useful for regions with templates

• Molecular Visualization Software:

  • PyMOL and Chimera: For analyzing predicted or experimental structures

  • VMD: Particularly useful for molecular dynamics simulation analysis

Functional Analysis Tools:

• Domain Identification:

  • InterProScan: Comprehensive functional analysis by scanning against multiple domain databases

  • SMART: Simple Modular Architecture Research Tool for domain annotation

  • Pfam: Protein family database for identifying conserved domains

• Machine Learning Resources:

  • RF_phage virion: Random forest model specifically designed for phage virion protein classification

  • Feature extraction tools for AAC and CKSAAP pattern analysis

Specialized Phage Databases:

• PhagesDB: Comprehensive database of bacteriophage genomes and annotations

• ViPR: Virus Pathogen Resource with specialized tools for viral protein analysis

• PHASTER: PHAge Search Tool Enhanced Release for identifying prophage sequences

Example Analysis Workflow:

To conduct a comprehensive analysis of IKe Virion export protein (IV), researchers typically implement the following workflow:

• Retrieve the canonical sequence from UniProt (P03667)

• Generate multiple sequence alignments with homologous proteins from other filamentous phages

• Apply transmembrane prediction tools to identify membrane-spanning regions

• Utilize RF_phage virion or similar classification tools to confirm virion protein status

• Submit sequence to structure prediction servers like AlphaFold2

• Compare predicted structures with available cryo-EM data

• Identify conserved functional motifs through domain analysis tools

This integrated bioinformatic approach provides researchers with a comprehensive understanding of Enterobacteria phage IKe Virion export protein (IV) from sequence to structure to function, facilitating hypothesis generation for experimental validation.

How can researchers use sequence-based predictions to guide experimental studies of Enterobacteria phage IKe Virion export protein (IV)?

Sequence-based predictions serve as powerful guides for experimental investigation of Enterobacteria phage IKe Virion export protein (IV), creating a synergistic relationship between computational and laboratory approaches. Researchers can systematically leverage these predictions to design targeted experiments that maximize insight while minimizing resource expenditure through the following strategic framework:

1. Functional Domain Mapping Strategy:

Sequence analysis of the 407-amino acid protein (residues 31-437) reveals distinct domains with predicted functions that can guide experimental design:

• N-terminal region (residues 31-150): Sequence patterns suggest membrane interaction capabilities, directing researchers to design:

  • Site-directed mutagenesis of key hydrophobic and charged residues

  • Fluorescently labeled truncation constructs for membrane localization studies

  • Synthetic peptide competition assays targeting this region

• Central domain (residues 151-300): Rich in charged residues and potential protein-protein interaction sites, guiding:

  • Yeast two-hybrid or pull-down assays with predicted interaction partners

  • Alanine scanning of charged residue clusters

  • Cross-linking mass spectrometry focused on this region

• C-terminal domain (residues 301-437): Contains conserved motifs likely involved in assembly, informing:

  • Deletion mutants to assess assembly competence

  • Chimeric protein construction with homologous phage proteins

  • Structural studies prioritizing this functionally critical region

2. Structure-Based Hypothesis Testing:

Machine learning models like RF_phage virion have demonstrated 91.84% accuracy in classifying virion proteins , providing confident predictions about structural features that can guide experimental design:

• Predicted secondary structure elements guide circular dichroism (CD) spectroscopy experiments to validate α-helical and β-sheet content

• Molecular dynamics simulations based on sequence-predicted structures generate testable hypotheses about conformational changes

• Predicted solvent-exposed regions direct epitope mapping for antibody generation

3. Evolutionary Conservation-Guided Approach:

Sequence comparison across filamentous phages reveals patterns of conservation that highlight functionally critical regions:

• Highly conserved residues become prime targets for mutagenesis studies

• Variable regions suggest host-specificity determinants for chimeric protein experiments

• Conservation patterns guide the design of degenerate primers for identifying novel homologues

4. Integrated Experimental Design Framework:

Table 3: Sequence Prediction-Based Experimental Design for IKe Protein IV Research

5. Iterative Refinement Process:

The most successful research programs implement an iterative cycle where:

• Initial sequence-based predictions guide preliminary experiments

• Experimental results refine computational models

• Updated predictions direct more focused experiments

• The cycle continues, progressively building a comprehensive understanding

By systematically applying this framework, researchers can efficiently progress from the known amino acid sequence of Enterobacteria phage IKe Virion export protein (IV) to a detailed understanding of its structure-function relationships, membrane interactions, and role in phage assembly, ultimately contributing to both fundamental phage biology and potential biotechnological applications.