Recombinant Enterobacteria phage lambda Holin (S)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributor.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specification.
Synonyms
S; Antiholin; Lysis inhibitor S-107
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Escherichia phage lambda (Bacteriophage lambda)
Target Names
S
Target Protein Sequence
MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYNGGAFTKTVIDATMCAIIAWFIRD LLDFAGLSSNLAYITSVFIGYIGTDSIGSLIKRFAAKKAGVEDGRNQ
Uniprot No.

Target Background

Function
The protein accumulates harmlessly in the cytoplasmic membrane until a critical concentration is reached. This triggers the formation of micron-scale pores (holes) in the membrane, leading to host cell membrane disruption and the release of endolysin into the periplasmic space. It plays a crucial role in the precise timing of host cell lysis. This protein, along with the endolysin and spanin proteins, participate in a sequential series of events that ultimately result in programmed host cell lysis, releasing mature viral particles from the host cell. This protein also counteracts the aggregation of holin molecules, thereby inhibiting premature pore formation.
Database Links

KEGG: vg:2703479

Protein Families
Lambdalikevirus holin family
Subcellular Location
Host cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and membrane topology of lambda holin S?

Lambda holin S (S105) is the prototype for class I holins, characterized by three transmembrane α-helical segments (TMSs) arranged in an N-out and C-in configuration . The protein typically consists of approximately 110 amino acyl residues . The structural topology is critical for its function, with the three TMSs anchoring the protein in the bacterial inner membrane. The transmembrane domains interact to form oligomeric structures that eventually lead to hole formation. Recent research using fluorescent microscopy has shown that these TMSs participate in the formation of two-dimensional rafts at cell poles approximately 100 seconds prior to cell lysis .

How does lambda holin S contribute to the bacteriophage lytic cycle?

Lambda holin S functions as part of a precisely regulated lysis system that terminates the infection cycle of phage λ. The lysis is mediated by three types of proteins, each targeting a different layer of the bacterial envelope: S105 holin disrupts the inner membrane, R endolysin degrades the peptidoglycan, and the Rz/Rz1 spanin complex targets the outer membrane . The holin accumulates harmlessly in the inner membrane until reaching a genetically programmed time, at which point it suddenly forms holes that allow the endolysin to access the peptidoglycan layer. Video microscopy studies have revealed that lysis typically occurs as a sudden, explosive event originating at a cell pole . This all-or-nothing lysis regulation provides a fitness advantage to the phage by optimizing the timing of bacterial host destruction and phage progeny release.

What distinguishes lambda holin S from other classes of holins?

Lambda holin S belongs to class I holins, which differ from other holin classes based on membrane topology:

Holin ClassTransmembrane SegmentsTopologyExamplesReference
Class IThreeN-out, C-inLambda S105
Class IITwoN-in, C-inS2168 of φ21
Class IIIOneN-in, C-outT4-like, T5-like phages

While lambda holin forms large, micron-scale holes in the bacterial membrane, other types like the class II S2168 pinholin make smaller channels (approximately 2 nm) that function by collapsing the proton motive force rather than allowing direct enzyme passage . These structural differences reflect functional adaptations to different lysis strategies across bacteriophages.

What is the molecular mechanism of lambda holin-mediated hole formation?

The mechanism of lambda holin hole formation involves a precisely timed oligomerization process. Research using time-lapse fluorescence microscopy has revealed that holins accumulate uniformly in the membrane until approximately 100 seconds before lysis, when they suddenly redistribute to form two-dimensional rafts primarily at the cell poles . This redistribution coincides with membrane potential collapse and is followed by large hole formation.

The process follows several distinct steps:

  • Initial uniform accumulation in the inner membrane

  • Sudden redistribution to cell poles

  • Formation of two-dimensional oligomeric rafts

  • Large hole formation leading to membrane permeabilization

  • Endolysin release into the periplasm

This sudden transition from a harmless membrane protein to a lethal hole-former represents a precisely regulated genetic timing mechanism that researchers have termed the "lysis clock" . The all-or-nothing nature of this process provides evolutionary advantages by optimizing the timing of progeny release.

How does the spatial distribution of lambda holin S determine the morphology of bacterial lysis?

Recent fluorescence microscopy studies have demonstrated that lambda holin S primarily oligomerizes at the cell poles and that this site of oligomerization is spatially correlated with the site of lytic rupture . This finding explains the previously observed polar lysis morphology characteristic of lambda-infected cells.

The correlation between holin localization and lysis site suggests that the physical properties of the bacterial membrane at the poles may facilitate holin oligomerization. Factors that might contribute to this preferential localization include:

  • Differences in membrane curvature at poles versus the cylindrical portion of the cell

  • Variations in lipid composition or fluidity at different cell regions

  • Interaction with pole-localized bacterial proteins

  • Potential nucleoid exclusion effects

Research has shown that the explosive nature of lysis starting at the pole results in a less refractile ghost cell that initially retains its rod-shaped morphology . This observation suggests that the pole represents a structural weak point once membrane integrity is compromised.

What is known about the regulatory mechanisms controlling lambda holin S expression and function?

Lambda holin S expression and function are regulated at multiple levels to ensure precisely timed lysis. The S gene of bacteriophage lambda encodes both the holin (S105) and an inhibitory antiholin (S107) through dual-start motifs, allowing for translational regulation . The ratio of holin to antiholin affects the timing of lysis.

At the functional level, holin activity is inhibited by the membrane potential until a critical concentration is reached. This creates a metastable state where accumulated holins can rapidly trigger hole formation upon membrane depolarization. The collapse of membrane potential serves as a trigger for the conformational changes necessary for hole formation.

Research indicates that this regulatory system allows for:

  • Fine-tuning of lysis timing based on environmental conditions

  • Coordination with other lysis proteins (endolysins and spanins)

  • Optimization of phage burst size

  • Adaptation to different host physiological states

This sophisticated regulatory network makes holins valuable models for studying precisely timed biological events and membrane protein dynamics.

What are the challenges in expressing and purifying lambda holin S for structural studies?

Expressing and purifying lambda holin S presents significant challenges for researchers due to its inherent toxicity to bacterial expression systems . When expressed, holins insert into membranes and form holes, which is lethal to host cells. This toxicity results in low protein yields that have hindered structural and functional analysis compared to other cell lytic proteins.

Recommended approaches to overcome these challenges include:

  • Tight expression control systems: Using inducible promoters with minimal leaky expression to prevent premature host cell death.

  • Co-expression with antiholins: Expressing inhibitory proteins alongside holins to neutralize their toxicity until purification.

  • Chemical synthesis approaches: Employing fluorenylmethyloxycarbonyl-based solid-phase peptide synthesis (Fmoc SPPS) instead of traditional bacterial expression systems . This method has successfully produced S2168 pinholin with intrinsic α-helical secondary structure in high yields.

  • Membrane-mimicking environments: Reconstituting purified holins in proteoliposomes (such as 1,2-dimyristoyl-sn-glycero-3-phosphocholine) to simulate a native-like environment for functional studies .

  • Fusion protein strategies: Creating fusion constructs that mask holin activity until specific protease cleavage during purification.

Each approach has specific advantages and limitations that researchers should consider based on their experimental goals and available resources.

What advanced biophysical techniques are most effective for studying lambda holin structure and dynamics?

Multiple biophysical techniques have been employed to study holin structure and dynamics, each providing complementary information:

TechniqueApplicationKey FindingsReference
Fluorescence microscopyIn vivo trackingPolar localization of holins before lysis
Electron paramagnetic resonanceMobility analysisDetermination of domain mobility in membrane
Solid-state NMRLipid-protein interactionsReveals hydrophobic core and phosphorus head group interactions
AI-based structure predictionTopology modelingPreliminary structural information for challenging membrane proteins
Native mass spectrometryOligomeric state analysisAnalysis of heterogeneous samples with low detection limits

Recent advancements suggest several promising techniques for further holin research:

  • Hydrogen deuterium exchange (HDX): For determining protein-protein or protein-lipid interactions and hidden conformations .

  • Fast photochemical oxidation of proteins (FPOP): For analyzing protein surface exposure and conformational changes .

  • Cross-linking mass spectrometry (XLMS): For elucidating structural relationships between protein domains and oligomerization interfaces .

  • Cryo-electron microscopy: For visualizing holin assemblies in membranes at near-atomic resolution.

  • Super-resolution microscopy: For tracking holin dynamics in living cells with nanometer precision.

These techniques collectively provide complementary data that can overcome the traditional barriers to understanding these lethal membrane-disrupting proteins.

How can researchers develop effective experimental systems to study lambda holin S function in vitro?

Developing effective in vitro systems for studying lambda holin S function requires careful consideration of membrane environments and measurement techniques. Based on recent advances, researchers should consider:

  • Proteoliposome reconstitution: Incorporating purified holin into liposomes composed of defined phospholipids to mimic bacterial membranes. Recent work has successfully used 1,2-dimyristoyl-sn-glycero-3-phosphocholine proteoliposomes to simulate a native-like environment .

  • Membrane potential assays: Developing systems to monitor membrane potential changes upon holin activation using voltage-sensitive dyes or ion-selective electrodes.

  • Real-time hole formation visualization: Employing techniques like atomic force microscopy or high-speed imaging to capture the dynamics of hole formation.

  • Controlled triggering systems: Creating methods to precisely trigger holin activation, such as through ionophores that dissipate membrane potential.

  • Endolysin translocation assays: Designing experiments to measure the passage of fluorescently labeled endolysins through holin-formed holes.

The ideal experimental system would integrate multiple measurement modalities to capture the complex, dynamic process of holin-mediated membrane disruption. Measurements should account for the all-or-nothing nature of holin activation and the rapidity of the hole formation process.

What are the latest discoveries about lambda holin's polar localization and its implications for lysis mechanisms?

Recent research using time-lapse fluorescence microscopy has revealed crucial aspects of lambda holin's spatial organization before lysis. Studies have demonstrated that holin most often oligomerizes at cell poles and that this site of oligomerization is spatially correlated with the site of lytic blowout . This discovery provides the molecular basis for the previously observed polar lysis morphology in lambda-infected cells.

Key findings include:

  • Holins redistribute from uniform membrane distribution to form two-dimensional rafts at the poles approximately 100 seconds prior to lysis .

  • The explosive lytic event typically originates at a cell pole, resulting in a less refractile ghost that initially retains rod-shaped morphology .

  • This polar preference likely reflects physiological advantages, as the polar membrane may have distinct compositional or structural properties.

  • The dynamics of redistribution suggest an all-or-nothing regulatory mechanism that provides fitness advantages through precise lysis timing .

These findings have significant implications for understanding bacteriophage lysis strategies and potentially for designing antimicrobial agents that target bacterial membranes. The rapid redistribution of holins also provides a model system for studying membrane protein dynamics and oligomerization in bacterial cells.

How do the structural and functional properties of lambda holin S compare to other bacteriophage lysis systems?

Lambda holin S represents one of several distinct lysis systems that have evolved in bacteriophages. Comparative analysis reveals important similarities and differences:

Lysis SystemKey ComponentsMechanismNotable FeaturesReference
Lambda canonical holinS105 holin, R endolysin, Rz/Rz1 spaninLarge hole formation allowing endolysin passagePolar localization, micron-scale holes
Φ21 pinholinS2168 pinholin, SAR endolysinSmall pinholes collapse proton motive force, activating SAR endolysins~2 nm heptameric channels, ~10³ channels per cell
T4 holin systemT holin, RI antiholinRegulated by antiholin, cleavable signal peptideComplex with periplasmic domain

The lambda holin system represents a canonical pathway where large holes allow direct passage of cytoplasmic endolysins to the periplasm. In contrast, pinholins like S2168 make smaller holes that function by collapsing the proton motive force, which then activates signal-anchor-release (SAR) endolysins already present in the periplasm .

The diversity of these systems reflects evolutionary adaptations to different host environments and lysis timing requirements. Despite these differences, the common theme of precisely regulated membrane disruption highlights the conserved function of controlled bacterial lysis for phage progeny release.

What potential biotechnological and biomedical applications have been proposed for lambda holin S?

Lambda holin S and other bacteriophage lysis proteins are gaining interest for various applications across scientific and medical fields:

  • Antimicrobial development: Holins can be developed as novel antimicrobials against drug-resistant bacteria. Research has shown that combined holin-endolysin constructs exhibit enhanced antimicrobial activity against multidrug-resistant gram-negative and gram-positive pathogens .

  • Targeted drug delivery: Studies have demonstrated the potential of holins for delivering proteins or nucleic acids to mammalian cells. Notably, the manipulation of lysis timing via holins in suicidal strains of Listeria monocytogenes has shown promise for delivering therapeutic molecules to human intestinal epithelial cells .

  • Anti-cancer applications: Lambda holin has shown capability to kill eukaryotic tumor cells, including human mammary and cervix carcinoma cell lines in vitro and human embryonic kidney cells in vivo. This effect is believed to occur through oligomerization in organelle membranes that share similarities with prokaryotic endosymbiont progenitors .

  • Controlled lysis for biotechnology: Engineered holin expression can be used for controlled release of intracellular products in biomanufacturing applications, improving yields of recombinant proteins or other bioproducts.

  • Membrane fusion applications: Similar to spanins, holins might be adapted for drug delivery through membrane fusion mechanisms, though this application requires further validation .

These diverse applications highlight the potential for adapting phage lysis systems to address challenges in medicine, biotechnology, and other fields.

What are the most promising approaches for determining high-resolution structures of lambda holin S?

Determining high-resolution structures of lambda holin S remains challenging due to its membrane protein nature and toxicity in expression systems. Several promising approaches for future structural studies include:

  • Advanced computational methods: AI-based structure prediction tools like AlphaFold have shown promise for predicting membrane protein structures. Tests with T4 holin T and antiholin RI demonstrated that AlphaFold could predict structures closely matching experimental data (RMSD = 0.688 angstroms for holin T) . These computational approaches could provide initial structural models to guide experimental work.

  • Hybrid experimental approaches: Combining multiple techniques like solid-state NMR, electron paramagnetic resonance, and cryo-electron microscopy could overcome the limitations of individual methods .

  • Native mass spectrometry: Advanced ion sources such as nano-electrospray ionization (nESI) and laser-induced liquid bead ion desorption (LILBID) show promise for analyzing membrane proteins in their native form with advantages including speed, ability to handle heterogeneous samples, and lower detection limits .

  • Chemical synthesis and labeling: Building on successful synthesis of other holins using Fmoc SPPS , researchers could incorporate specific labels for structural studies, potentially enabling structure determination without traditional expression systems.

  • Membrane mimetics optimization: Developing better membrane mimetics that stabilize holin in its native conformation while being compatible with structural biology techniques could facilitate crystallization or NMR studies.

The combination of these approaches, particularly the integration of computational predictions with experimental validation, represents the most promising path toward determining high-resolution lambda holin structures.

What are the unresolved questions about lambda holin oligomerization and hole formation dynamics?

Despite recent advances, several fundamental questions about lambda holin oligomerization and hole formation remain unresolved:

  • Oligomerization triggers: What molecular triggers initiate the sudden redistribution of holins to cell poles? Is this purely concentration-dependent or influenced by other factors?

  • Hole size regulation: How is the size of holin-formed holes regulated, and what determines the transition from small oligomers to large, functional holes?

  • Polar localization mechanisms: What specific membrane properties at bacterial poles facilitate holin oligomerization? Are there interactions with pole-specific bacterial proteins?

  • Temporal regulation: How is the approximately 100-second window between holin redistribution and lysis determined and regulated?

  • Membrane composition effects: How do specific lipid compositions affect holin oligomerization and function? Are there specific lipid requirements for optimal activity?

  • Coordination with other lysis proteins: How is holin activity coordinated with endolysin and spanin function for efficient lysis?

Addressing these questions will require innovative experimental approaches combining single-molecule tracking, super-resolution microscopy, and biophysical techniques applied to both in vivo and reconstituted systems.

How might synthetic biology approaches advance our understanding and application of lambda holin S?

Synthetic biology offers promising approaches to both understand lambda holin function and develop novel applications:

  • Engineered lysis timing: Developing synthetic genetic circuits to precisely control holin expression and activation could enable fine-tuned lysis timing for biotechnological applications. This could improve yields in bioprocessing by optimizing the release of intracellular products.

  • Domain swapping and chimeric holins: Creating chimeric holins by swapping domains between different holin types could reveal functional determinants and potentially create holins with novel properties or host ranges.

  • Minimal holin design: Determining the minimal structural requirements for holin function could lead to simplified, synthetic holins optimized for specific applications.

  • Conditional holin systems: Developing holins that respond to specific environmental signals could create sophisticated biosensors or conditional lysis systems for targeted applications.

  • Non-natural amino acid incorporation: Using expanded genetic codes to incorporate non-natural amino acids at specific positions could provide new tools for studying holin structure-function relationships and potentially create holins with enhanced properties.

  • Cell-free expression systems: Developing cell-free systems for holin expression could overcome toxicity issues while enabling high-throughput functional studies.

These synthetic biology approaches could not only advance fundamental understanding of holin biology but also facilitate the development of holins as tools for biotechnology, medicine, and other applications.

What are the recommended protocols for expressing recombinant lambda holin S while minimizing toxicity to the expression host?

Expressing recombinant lambda holin S requires strategies to mitigate its toxicity to bacterial hosts. Based on current research, the following protocols are recommended:

  • Tightly regulated expression systems:

    • Use the T7 expression system with the pLysS plasmid to suppress basal expression

    • Employ arabinose-inducible promoters with glucose suppression during growth phase

    • Consider tetracycline-responsive systems with doxycycline induction at low temperatures (16-18°C)

  • Co-expression with inhibitory elements:

    • Co-express the lambda S107 antiholin to neutralize holin activity

    • Include the T4 RI antiholin, which has been shown to inhibit lambda holin

    • Consider fusion to inhibitory domains that can be later removed by specific proteases

  • Alternative synthesis approaches:

    • Use Fmoc SPPS (fluorenylmethyloxycarbonyl-based solid-phase peptide synthesis) which has successfully produced other holins without traditional expression systems

    • Explore cell-free protein synthesis systems that can produce membrane proteins without cellular toxicity

  • Optimization parameters:

    • Reduce temperature to 16-20°C after induction

    • Use minimal inducer concentrations determined by titration

    • Limit expression time to prevent accumulation of toxic levels

    • Consider addition of membrane-stabilizing agents during expression

These approaches can be combined for additive effects, with the specific protocol optimized based on the experimental goals and subsequent purification requirements.

What imaging techniques and fluorescent protein fusions are most effective for studying lambda holin dynamics in living cells?

Advanced imaging techniques have provided crucial insights into lambda holin dynamics. Based on recent research, the following approaches are recommended:

  • Recommended fluorescent protein fusions:

    • C-terminal GFP fusions maintain holin functionality while enabling visualization

    • mNeonGreen provides superior brightness and photostability compared to GFP

    • Split fluorescent proteins can be used to specifically detect oligomerized holins

    • photoactivatable or photoswitchable fluorescent proteins for super-resolution microscopy

  • Microscopy techniques:

    • Time-lapse fluorescence microscopy at intervals of 10-20 seconds captures the rapid redistribution prior to lysis

    • Total internal reflection fluorescence (TIRF) microscopy provides enhanced resolution of membrane events

    • Fluorescence recovery after photobleaching (FRAP) to measure diffusion dynamics

    • Förster resonance energy transfer (FRET) to detect holin-holin interactions and oligomerization

  • Additional fluorescent probes:

    • Membrane potential indicators (DiBAC4, TMRM) to correlate holin activity with membrane depolarization

    • Membrane-impermeable nucleic acid dyes to precisely time permeabilization events

    • Fluorescently-labeled endolysins to track translocation through holin holes

  • Imaging parameters:

    • Use minimal illumination to prevent phototoxicity while maintaining temporal resolution

    • Employ environmental chambers to maintain optimal temperature and pH

    • Consider microfluidic platforms for precise control of infection conditions

These imaging approaches, particularly when combined with quantitative image analysis, can provide detailed insights into the dynamic behavior of holins during the lytic cycle.

How can researchers effectively combine computational and experimental approaches to advance lambda holin research?

Integrating computational and experimental methods offers a powerful strategy for advancing lambda holin research:

  • Recommended computational approaches:

    • Use AI-based structure prediction tools like AlphaFold to generate initial structural models

    • Employ molecular dynamics simulations to study holin-membrane interactions

    • Develop mathematical models of holin oligomerization and hole formation kinetics

    • Use systems biology approaches to model the lysis timing network

  • Integration strategies:

    • Design experiments to specifically test computational predictions

    • Use computational models to interpret experimental results

    • Iteratively refine models based on experimental feedback

    • Generate multiple alternative hypotheses computationally for experimental testing

  • Specific combined methodologies:

    • Use predicted structures to design site-directed mutagenesis experiments

    • Employ computational lipid binding predictions to guide membrane mimetic composition

    • Develop machine learning approaches to analyze complex microscopy data

    • Use computational design to engineer holins with novel properties for experimental validation

  • Data management considerations:

    • Establish databases integrating computational and experimental data

    • Develop standardized formats for sharing models and experimental results

    • Implement version control for tracking model refinements based on new data

This integrated approach has already shown promise with the structural modeling of T4 holin T and antiholin RI, where AlphaFold predictions closely matched experimental structures (RMSD = 0.688 angstroms) . Expanding this approach to lambda holin S could accelerate progress in understanding its structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.