Recombinant Enterobacteria phage lambda Protein rexB (rexB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery time information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rexB; lambdap53; Protein rexB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Escherichia phage lambda (Bacteriophage lambda)
Target Names
rexB
Target Protein Sequence
MRNRIMPGVYIVIIPYVIVSICYLLFRHYIPGVSFSAHRDGLGATLSSYAGTMIAILIAA LTFLIGSRTRRLAKIREYGYMTSVVIVYALSFVELGALFFCGLLLLSSISGYMIPTIAIG IASASFIHICILVFQLYNLTREQE
Uniprot No.

Target Background

Function
RexB may play a role in viral genome replication by preventing the degradation of lambda-O protein (a protein involved in DNA replication). It may also protect the host cell from death under conditions of nutrient starvation.
Gene References Into Functions
  1. The phage lambda rexB gene not only safeguards the prophage state by preventing the death of its E. coli host but is also indirectly involved in the lysogenic-lytic switch [review] PMID: 25684601
  2. Expression under conditions of polarity is subject to 10Sa RNA tagging and ClpXP degradation PMID: 15782233
Database Links

KEGG: vg:2703493

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the phage lambda rexB protein and what is its primary function?

The rexB protein is encoded by the bacteriophage lambda gene rexB, which together with rexA forms the Rex system. This system primarily functions to exclude (prevent the growth of) certain other bacteriophages, most notably T4 rII mutants. The Rex exclusion system functions as a two-component system that aborts lytic growth of bacterial viruses . The RexB protein is a polytopic transmembrane protein that appears to form ion channels in the bacterial membrane . When expressed along with RexA, these channels can respond to lytic growth of bacteriophages by depolarizing the cytoplasmic membrane, leading to termination of macromolecular synthesis, loss of active transport, ATP hydrolysis, and ultimately cell death . This exclusion mechanism represents a fascinating example of viral competition and bacterial molecular defense systems.

How is rexB regulated in the phage lambda genome?

The rexB gene is expressed from two distinct promoters in the phage lambda genome. The primary promoter is P<sub>RM</sub>, which also drives expression of rexA and the cI repressor gene in lambda lysogens . Additionally, rexB is expressed from a second promoter, P<sub>LIT</sub>, which is embedded within the rexA gene . This dual regulation is significant because it allows differential expression of RexA and RexB, resulting in varying ratios of these proteins. The ratio of RexA to RexB appears to be critically important for modulating cellular phenotypes, particularly UV sensitivity . A mutation in the P<sub>LIT</sub> promoter (P<sub>LIT</sub>-10) causes reduced expression of RexB relative to RexA, which increases UV sensitivity and leads to premature asynchronous lysis of heat-induced cI 857 lysogens .

How does rexB contribute to phage lambda's survival strategy?

Beyond its role in phage exclusion, rexB serves as an "anti-cell death" gene that confers significant survival advantages to lambda lysogens. Research has demonstrated that RexB prevents cell death directed by two different addiction modules: the phd-doc of plasmid prophage P1 and the rel mazEF system of E. coli . The latter is induced by the signal molecule guanosine 3′,5′-bispyrophosphate (ppGpp) during amino acid starvation . RexB accomplishes this protective function by inhibiting the degradation of the antitoxic labile components Phd and MazE, which are substrates of ClpP proteases . This protective mechanism allows lambda lysogens to survive under conditions of nutrient starvation. Additionally, RexB prevents degradation of the λ O protein, which is essential for λ DNA replication . These functions collectively suggest that the rex operon may be considered a "survival operon" of phage lambda, providing multiple advantages to lysogenized cells .

What is the molecular structure of rexB protein?

The RexB protein is a membrane-integrated protein with a complex topology. Studies using RexB-alkaline phosphatase fusions have revealed that RexB is a polytopic transmembrane protein with four transmembrane domains . The fourth transmembrane domain contains a critical pentapeptide sequence (Ile-His-Ile-Cys-Ile) that appears crucial for stable membrane integration . Mutations affecting this region result in altered hydrophobicity and compromise the protein's ability to function as a stable transmembrane element . This structural arrangement allows RexB to form ion channels in the bacterial membrane, which is essential for its functions in both phage exclusion and prevention of cell death . The membrane topology of RexB is strategically designed to respond to specific signals during phage infection and modulate membrane permeability accordingly.

What are the known interactions between rexB and other proteins?

Bacterial adenylate cyclase two-hybrid system (BACTH) analyses have revealed several important protein-protein interactions involving RexB. The RexB protein physically interacts with other phage proteins including RexA, Ren, and the phage replication initiator protein O . These interactions are critical for the various functions of RexB in phage exclusion, prevention of self-exclusion, and DNA replication. Additionally, screening of an E. coli two-hybrid library has identified several bacterial proteins that interact with RexB, suggesting that RexB engages with host cellular machinery to execute its various functions . The interactions with host proteins likely contribute to RexB's ability to modulate cellular processes such as redox regulation and protein degradation pathways. These protein-protein interactions provide insight into the molecular mechanisms underlying RexB's diverse functional roles.

What experimental systems are used to study rexB function?

Several experimental systems have been developed to study rexB function:

  • Phage exclusion assays: Cross-streaking experiments can be used to demonstrate Rex exclusion of T4 rII mutants and lambda ren mutants in lysogenic bacteria. For example, growth of T4 rII deletion mutant r638 is restricted in lambda lysogens but permitted in strains overexpressing RexB .

  • UV sensitivity assays: Bacterial strains expressing the phage immunity region show increased UV sensitivity when RexA and RexB are co-expressed. This sensitivity varies with the ratio of RexA to RexB and can be reduced by expression of Ren . The following table summarizes key phenotypes observed in UV sensitivity experiments:

StrainRexA/RexB ExpressionP<sub>LIT</sub> StatusUV SensitivityEffect of Ren Expression
LT732NormalWild-typeIncreasedRescues sensitivity
LT1964Higher RexA:RexB ratioP<sub>LIT</sub>-10 mutantSeverely increasedLargely restores resistance
  • Lysis phenotype assays: Heat-induced cI 857 lysogens with normal expression of RexA and RexB exhibit aberrant lysis phenotypes that can be rescued by Ren expression .

  • Protein degradation assays: Systems to monitor degradation of short-lived proteins like the λ O protein or the MazE protein in the presence or absence of functional RexB .

These experimental systems allow researchers to dissect the multiple functions of RexB and its interactions with other cellular components.

How can the membrane topology of rexB be determined experimentally?

The membrane topology of RexB can be determined through several complementary approaches:

  • RexB-alkaline phosphatase fusion analysis: This approach has been extensively used to map the transmembrane domains of RexB . By creating fusion proteins between RexB fragments and alkaline phosphatase (PhoA), researchers can determine which portions of the protein are exposed to the periplasm (high phosphatase activity) versus those located in the cytoplasm (low activity). Analysis of several RexB-PhoA fusion proteins has supported a model where RexB contains four transmembrane domains .

  • Cell fractionation studies: Cellular fractionation techniques can be used to determine the subcellular localization of RexB. These experiments have confirmed that RexB is primarily located in the inner membrane of E. coli .

  • Hydropathy plot analysis: Computational analysis of the RexB amino acid sequence can predict potential transmembrane domains based on hydrophobicity patterns. These predictions can then be validated through experimental approaches.

  • Cysteine-scanning mutagenesis: Systematic replacement of amino acids with cysteine residues, followed by accessibility studies using membrane-permeable and membrane-impermeable sulfhydryl reagents, can provide detailed information about which residues are exposed to different cellular compartments.

  • Protease protection assays: These assays can determine which portions of RexB are accessible to proteases from different sides of the membrane, providing further evidence for its topology.

Combined, these methods have established that RexB is a polytopic transmembrane protein with four membrane-spanning domains, providing crucial structural insights for understanding its function.

What methods are used to study rexB-protein interactions?

Several methods have been employed to investigate interactions between RexB and other proteins:

  • Bacterial adenylate cyclase two-hybrid system (BACTH): This approach has been particularly valuable for identifying protein-protein interactions involving RexB. In this system, potential interacting proteins are fused to complementary fragments of adenylate cyclase. When the proteins interact, functional adenylate cyclase is reconstituted, leading to cAMP production and activation of cAMP-dependent genes like β-galactosidase . Using this system, researchers have demonstrated interactions between RexB and other phage proteins including RexA, Ren, and the phage replication initiator protein O .

  • E. coli two-hybrid library screening: Researchers have screened E. coli two-hybrid libraries to identify bacterial proteins that interact with RexB. In these screens, candidate cells containing interacting clones express cAMP, allowing their growth and identification on minimal maltose selective agar. Once interacting plasmid pairs are identified, β-galactosidase activity can be measured to quantify the strength of interactions .

  • Co-immunoprecipitation assays: These can be used to verify interactions identified in two-hybrid screens and to identify additional interaction partners from cell lysates.

  • Pull-down assays with purified proteins: Using purified recombinant proteins, direct interactions can be assessed through pull-down experiments with tagged versions of RexB.

  • Fluorescence resonance energy transfer (FRET): For interactions occurring in living cells, FRET techniques using fluorescently tagged proteins can provide spatial and temporal information about RexB interactions.

These approaches have collectively revealed that RexB engages in a complex network of interactions with both phage and bacterial proteins, contributing to its diverse functional roles.

How can researchers generate recombinant rexB protein for experimental studies?

Generation of recombinant RexB protein presents challenges due to its transmembrane nature, but several approaches can be employed:

  • Expression vector selection: The rexB gene can be cloned into expression vectors with inducible promoters like T7 or arabinose-inducible systems. For example, researchers have successfully used the arabinose-inducible P<sub>BAD</sub> promoter to express Ren protein, which interacts with RexB . Similar approaches can be adapted for RexB expression.

  • Fusion tag strategies: Adding solubility-enhancing tags (such as MBP, GST, or SUMO) can improve expression and purification of membrane proteins like RexB. These tags can often be removed by specific proteases after purification.

  • Membrane protein extraction: Specialized detergents (such as n-dodecyl-β-D-maltoside, digitonin, or CHAPS) can be used to solubilize RexB from membranes while maintaining its native conformation.

  • Reconstitution into liposomes or nanodiscs: After purification, RexB can be reconstituted into artificial membrane systems to study its ion channel activity and interactions with other proteins.

  • Cell-free protein synthesis: For difficult-to-express membrane proteins, cell-free systems supplemented with lipids or detergents can provide an alternative approach for producing functional protein.

When designing expression constructs, researchers should consider:

  • Codon optimization for the expression host

  • Signal sequences for proper membrane targeting

  • Strategic placement of purification tags to avoid interfering with transmembrane domains

  • Potential toxicity of overexpressed RexB, which may necessitate tight regulation of expression

These approaches enable the production of recombinant RexB for biochemical, structural, and functional studies.

What methods can detect changes in rexB-mediated membrane permeability?

As RexB appears to form ion channels that can depolarize the cytoplasmic membrane, several techniques can be used to monitor these activities:

  • Membrane potential-sensitive fluorescent dyes: Dyes like DiSC3(5) (3,3'-dipropylthiadicarbocyanine iodide) or DiBAC4(3) (bis-(1,3-dibutylbarbituric acid)trimethine oxonol) change their fluorescence properties in response to membrane potential changes and can be used to monitor RexB-mediated membrane depolarization in real-time.

  • Patch-clamp electrophysiology: When reconstituted into planar lipid bilayers or expressed in suitable cells, patch-clamp techniques can directly measure ion conductance through RexB channels, providing detailed information about channel properties, ion selectivity, and gating mechanisms.

  • Ion flux measurements: Radioisotope-labeled ions (e.g., 22Na+, 45Ca2+, 86Rb+ as a K+ analog) can be used to measure ion movement across membranes in the presence of RexB.

  • ATP depletion assays: Since Rex exclusion is characterized by ATP hydrolysis , measuring cellular ATP levels can provide an indirect assessment of RexB activity.

  • Proton motive force (PMF) measurements: Techniques to measure components of the PMF (ΔpH and Δψ) can reveal how RexB affects cellular energetics. This is particularly relevant as Rex exclusion of T4 rII mutants involves loss of PMF .

  • NAD+ leakage assays: Since T4 rII exclusion by the Rex system is associated with NAD+ leakage , measuring extracellular NAD+ can provide evidence of RexB channel activity.

These approaches provide complementary information about how RexB affects membrane integrity and cellular energetics, helping to elucidate its mechanism of action in both phage exclusion and cell survival contexts.

How does the ratio of RexA to RexB affect cellular phenotypes?

The ratio of RexA to RexB appears to be a critical factor in determining cellular phenotypes, particularly regarding UV sensitivity and cell survival. Research has demonstrated that:

These findings suggest that the RexA:RexB ratio is precisely regulated to optimize phage and host survival under different environmental conditions. Research methodologies to investigate this relationship include constructing strains with altered expression levels of each protein, using promoter mutations or controlled expression systems, and measuring phenotypic outcomes under various stressors.

What is the molecular mechanism of rexB-mediated exclusion of T4 rII mutants?

The molecular mechanism of T4 rII exclusion by the Rex system involves several interconnected processes:

  • Membrane depolarization: Evidence suggests that RexB forms ion channels that, when activated by RexA in response to T4 rII infection, depolarize the cytoplasmic membrane . This depolarization disrupts the proton motive force (PMF) required for cellular energy production.

  • Energy metabolism disruption: T4 rII-infected λ lysogens display significant defects in energy metabolism . The T4 RIIA and RIIB proteins normally associate with the E. coli inner membrane and the T4 DNA replication complex, potentially providing increased energy during glycolysis .

  • Loss of macromolecular synthesis: Rex exclusion is characterized by termination of macromolecular synthesis, including DNA, RNA, and protein synthesis . This effectively halts phage replication.

  • ATP hydrolysis: The Rex system triggers extensive ATP hydrolysis, depleting cellular energy reserves .

  • NAD+ leakage: T4 rII exclusion is associated with NAD+ leakage from cells . Since NAD+ is a critical cofactor for many cellular processes, including DNA ligase activity, this leakage could contribute to replication and recombination defects.

The following table summarizes the key features of phage exclusion by the Rex system:

Phage MutantFunction TargetedDysfunction
T4 rIIRecombination-dependent DNA replicationLoss of PMF, ATP hydrolysis, Inhibition of macromolecular synthesis, NAD+ leakage
Heteroimmune λ redRecombinationInhibition of macromolecular synthesis (likely similar to T4 rII)
Heteroimmune λ renUnknown-

This complex mechanism represents a fascinating example of viral competition and defense strategies.

How does rexB prevent cell death mediated by addiction modules?

RexB functions as an anti-cell death protein by interfering with bacterial addiction modules through the following mechanisms:

  • Inhibition of proteolysis of antitoxins: RexB prevents the degradation of short-lived antitoxic proteins in two different addiction modules:

    • The MazE protein of the mazEF system in E. coli

    • The Phd protein of the phd-doc system from prophage P1

  • Interaction with proteolytic machinery: Evidence suggests that RexB may act on the ClpP proteolytic subunit, which is responsible for degrading these antitoxic proteins . By inhibiting ClpP activity, RexB allows antitoxins to accumulate and neutralize their corresponding toxins.

  • Prevention of ppGpp-induced cell death: The mazEF addiction module is induced by the stringent response alarmone guanosine 3′,5′-bispyrophosphate (ppGpp), which accumulates during amino acid starvation . By stabilizing MazE, RexB protects cells from death during nutrient limitation.

  • Modification of protease specificity: Rather than completely inhibiting proteolysis, RexB may alter the substrate specificity of proteases, selectively preventing degradation of certain proteins while allowing normal turnover of others.

This protection mechanism represents an important benefit for bacteria harboring lambda prophages, as it allows lysogenized cells to survive under stress conditions that would normally trigger programmed cell death. Methodologically, these effects can be studied by monitoring the stability of tagged versions of these antitoxins in the presence or absence of functional RexB under various stress conditions.

What is the relationship between rexB and DNA metabolism?

RexB appears to influence DNA metabolism through several interconnected mechanisms:

  • Stabilization of λ O protein: RexB prevents degradation of the short-lived λ O protein, which is essential for λ DNA replication . When a nonsense mutation is present in rexB, the λ O protein becomes labile; suppression of this mutation restores O protein stability . This stabilization can be achieved both in cis and in trans.

  • Influence on redox state: Research suggests that concurrent expression of RexA and RexB biases the cellular redox state toward reduction . This altered redox state may result in NAD+ limitation, which in turn restricts functional DNA ligase activity since DNA ligase requires NAD+ as a cofactor .

  • Impact on recombination and replication: Limited DNA ligase activity due to NAD+ restriction could lead to defects in DNA replication and recombination . This might explain why λ red, ren, and gam mutants (all involved in DNA metabolism) are sensitive to RexAB-mediated exclusion.

  • Interaction with the RecBCD pathway: Defects in RecB and RecC functions are extragenic suppressors of RexAB-mediated exclusion of λ gam mutants . Additionally, Chi sites that activate RecBCD-mediated recombination can suppress this exclusion. This suggests a complex interplay between RexB and recombination pathways.

  • Physical interactions with replication machinery: Two-hybrid analyses have demonstrated physical interactions between RexB and various components of DNA metabolism, including the phage replication initiator protein O .

These findings collectively suggest that RexB plays a significant role in modulating DNA metabolism, likely as part of its function in regulating phage development and survival.

How does rexB interact with cellular redox systems?

The interaction between rexB and cellular redox systems represents an emerging area of research with significant implications for understanding phage-host interactions:

  • Redox state modulation: Evidence suggests that concurrent expression of RexA and RexB biases the oxidation-reduction (redox) state of the cell toward reduction . This redox shift appears to be a key mechanism underlying several RexB functions.

  • NAD+ limitation: The reduced cellular redox state resulting from RexAB expression may lead to NAD+ limitation . Since NAD+ is a critical cofactor for many cellular processes, including DNA ligase activity, this limitation has widespread effects on cellular metabolism.

  • Counter-regulation by Ren protein: The Ren protein appears to counteract the effects of RexA and RexB on cellular redox state . One proposed mechanism is that Ren promotes thiolation of lysine transfer RNA (tRNA), which can counteract a highly reduced redox state .

  • Redox sensing: RexB may function as part of a redox-sensing system that monitors cellular metabolic status and adjusts phage development accordingly. This sensing mechanism could help optimize phage replication under different host metabolic conditions.

  • Membrane potential effects: The apparent ion channel activity of RexB likely influences the proton motive force and electron transport chain, further connecting RexB function to cellular redox processes .

A model emerging from these observations suggests that the λ Rex system and Ren protein work in opposition to modulate cellular redox state, fine-tuning the bacterial cell's metabolism to benefit phage development. This redox modulation represents a sophisticated mechanism by which phages can manipulate host physiology to optimize their replication and survival.

What are the current contradictions in our understanding of rexB function?

Several contradictions and unresolved questions exist in our current understanding of rexB function:

  • Dual role as exclusion and anti-exclusion factor: RexB is required for Rex exclusion of other phages when expressed with RexA, yet overexpression of RexB prevents this same exclusion . This apparent contradiction suggests a complex dose-dependent mechanism that remains incompletely understood.

  • Protective vs. lethal effects: RexB exhibits protective functions (preventing cell death from addiction modules, stabilizing proteins) , yet it also participates in the Rex exclusion system that causes cell death during infection by certain phages . The molecular switch that determines these opposing outcomes remains unclear.

  • Mechanism of protein stabilization: While RexB clearly prevents degradation of certain proteins (λ O, MazE, Phd) , the exact mechanism remains debated. Does RexB directly inhibit proteases, sequester target proteins, or influence cellular conditions that affect proteolysis?

  • Relationship between membrane ion channel activity and protein stabilization: It's not immediately obvious how RexB's apparent ion channel function relates to its ability to prevent protein degradation. Are these separate functions or mechanistically linked?

  • Evolutionary purpose: The evolutionary advantage of the Rex system for lambda is still debated. Is its primary function to exclude competing phages, to protect lysogens during stress, or to regulate phage development? The multiple functions of RexB complicate this question.

Resolving these contradictions will require sophisticated genetic, biochemical, and structural approaches that can distinguish between direct and indirect effects and capture the dynamic nature of RexB function under different conditions.

What methodological challenges exist in studying rexB function?

Researchers face several significant methodological challenges when studying rexB:

  • Membrane protein analysis: As a transmembrane protein, RexB presents all the typical challenges associated with membrane protein research, including difficulties in expression, purification, and structural analysis. Detergent selection, stability issues, and maintaining native conformation are persistent concerns.

  • Separating direct from indirect effects: RexB influences multiple cellular processes including membrane potential, redox state, protein degradation, and DNA metabolism. Distinguishing direct effects from downstream consequences requires carefully designed genetic and biochemical approaches.

  • Complex genetic interactions: The phenotypes associated with RexB expression are often dependent on genetic background and the presence of other factors (RexA, Ren). This genetic complexity makes it challenging to isolate and characterize specific RexB functions.

  • Transient protein-protein interactions: Some interactions involving RexB may be transient or condition-dependent, making them difficult to capture using standard interaction assays.

  • Pleiotropic effects: Mutations in rexB or altered expression levels can have pleiotropic effects on cellular physiology, complicating the interpretation of experimental results.

  • Ion channel characterization: If RexB indeed forms ion channels, specialized electrophysiological techniques are required to characterize their properties, which may not be readily available in laboratories focused on phage biology.

  • Conditional phenotypes: Many RexB phenotypes are only manifest under specific conditions (phage infection, stress, etc.), requiring carefully designed experimental setups to observe and measure.

To address these challenges, researchers should consider integrating multiple complementary approaches, including genetic, biochemical, and biophysical methods, and carefully control for indirect effects through appropriate experimental designs.

How might the functions of rexB vary across different bacterial hosts?

The functions and effects of RexB may vary significantly across different bacterial hosts due to several factors:

  • Host-specific protein interactions: RexB interacts with various host proteins, and these interaction partners may differ between bacterial species or even strains. Two-hybrid screening has identified several E. coli proteins that interact with RexB , but analogous proteins may be absent or different in other hosts.

  • Variation in membrane composition: Since RexB is a membrane protein that appears to form ion channels, differences in membrane composition between bacterial species could affect its insertion, folding, and channel properties.

  • Differences in proteolytic machinery: RexB's ability to prevent degradation of certain proteins depends on the host's proteolytic systems. Variations in protease specificity, regulation, or abundance across bacterial species could significantly impact this function.

  • Metabolic and redox differences: RexB's effects on cellular redox state and metabolism may vary depending on the metabolic capabilities and redox regulation of the host bacterium.

  • Interaction with host defense systems: Different bacterial species possess various defense mechanisms against phage infection, which might interact differently with RexB functions.

To investigate these variations, researchers could:

  • Express rexB in diverse bacterial hosts and assess phenotypes such as exclusion activity and protein stabilization

  • Perform interaction screening in different bacterial backgrounds

  • Compare the effects of rexB expression on membrane potential and cellular metabolism across hosts

  • Examine the ability of rexB to protect against addiction modules in various bacterial species

Understanding these host-specific variations would provide valuable insights into the evolution and adaptation of the Rex system across different bacterial environments.

What are the implications of rexB research for understanding phage-host interactions?

Research on rexB has broader implications for understanding phage-host interactions at multiple levels:

  • Molecular warfare between phages: The Rex exclusion system represents a fascinating example of competition between phages for bacterial hosts. By preventing the replication of certain other phages, lambda lysogens gain a competitive advantage. This exemplifies the complex evolutionary arms race between viruses sharing the same ecological niche.

  • Phage manipulation of host physiology: RexB's diverse effects on host processes—including membrane potential, protein degradation, redox state, and DNA metabolism—illustrate how phages can extensively reprogram host physiology to create an environment favorable for their own survival and reproduction.

  • Stress protection mechanisms: The ability of RexB to protect against cell death during starvation and other stresses suggests that lysogeny can provide adaptive advantages to the host under certain environmental conditions. This challenges the traditional view of phages as purely parasitic entities.

  • Molecular switches in phage development: The complex interplay between RexB, RexA, and Ren in modulating cellular processes may represent molecular switches that help regulate the decision between lytic and lysogenic development.

  • Evolution of multi-functional viral proteins: RexB exemplifies how viral proteins can evolve multiple functions that collectively enhance viral fitness through diverse mechanisms. This multi-functionality may be a common feature of viral proteins that must maximize their functional impact within strict size constraints.

  • Potential biotechnological applications: Understanding RexB's ability to prevent protein degradation and protect against cell death could have applications in biotechnology, such as improving protein production or engineering stress-resistant bacteria.

These insights contribute to our fundamental understanding of virus-host interactions and may inform strategies for phage therapy, synthetic biology, and other biotechnological applications.

What are the unresolved questions about rexB's evolutionary significance?

Several important questions remain regarding the evolutionary significance of rexB:

  • Origin and acquisition: The evolutionary origin of the rexAB genes and how they were acquired by phage lambda remains unclear. Comparative genomic analysis across diverse phages could help trace the evolutionary history of these genes.

  • Selective pressures: What selective pressures drove the evolution and maintenance of the Rex system? Is exclusion of competing phages the primary advantage, or are the cell protection functions more important evolutionarily?

  • Co-evolution with host systems: How have RexB functions co-evolved with host cellular machinery, particularly proteolytic systems and stress response pathways? Has this co-evolution shaped the specificity and regulation of RexB's activities?

  • Variability across phage populations: How variable are rexA and rexB sequences across natural lambda populations, and do these variations correlate with functional differences or host adaptations?

  • Evolutionary relationship with Ren: The functional opposition between the Rex system and Ren protein suggests a complex evolutionary relationship. Did these systems evolve together as a regulatory module, or were they acquired independently?

  • Conservation across phage families: To what extent are Rex-like systems conserved across different phage families, and what does this tell us about their evolutionary importance?

  • Host range implications: How does the presence of the Rex system affect the host range of phage lambda? Does it restrict potential hosts due to incompatibilities with certain bacterial systems?

Answering these questions would require approaches such as:

  • Comparative genomic analysis across diverse phages and their hosts

  • Experimental evolution studies under different selective pressures

  • Phylogenetic analysis of RexA, RexB and related proteins

  • Functional characterization of Rex systems from diverse phage isolates

These investigations would provide valuable insights into the evolutionary forces shaping virus-host interactions and the development of complex regulatory systems in phages.

What are the key takeaways about rexB function and significance?

The bacteriophage lambda protein RexB represents a multifunctional viral protein with significant implications for phage-host interactions. Key takeaways from current research include:

  • RexB is a polytopic transmembrane protein that appears to form ion channels in the bacterial membrane, playing a crucial role in the Rex exclusion system that prevents the growth of certain bacteriophages, particularly T4 rII mutants .

  • Beyond phage exclusion, RexB functions as an "anti-cell death" protein that protects lysogenized cells from programmed cell death mediated by bacterial addiction modules and starvation-induced stress responses .

  • RexB prevents degradation of several short-lived proteins, including the antitoxic components of addiction modules (MazE, Phd) and the lambda replication protein O, suggesting a general role in modulating proteolysis .

  • The ratio of RexA to RexB is critically important for determining cellular phenotypes, with imbalances leading to increased UV sensitivity and aberrant lysis .

  • RexB appears to influence cellular redox state and NAD+ availability, which has downstream effects on DNA metabolism through NAD+-dependent enzymes like DNA ligase .

  • Overexpression of RexB prevents Rex exclusion, suggesting it functions in a dose-dependent manner with different effects at different concentrations .

  • The complex interactions between RexB, RexA, and Ren highlight sophisticated regulatory mechanisms that may help optimize phage development under different conditions .

These diverse functions collectively suggest that the rex operon may be considered a "survival operon" for phage lambda, providing multiple advantages to both the phage and its lysogenized host under various environmental conditions.

How might future research on rexB advance our understanding of phage biology?

Future research on rexB holds significant potential to advance our understanding of phage biology in several key areas:

  • Structural biology: Determining the three-dimensional structure of RexB, particularly its membrane topology and potential channel-forming regions, would provide crucial insights into its mechanism of action and could enable rational design of modulators of RexB function.

  • Systems biology approaches: Global analyses of how RexB expression affects host transcriptome, proteome, and metabolome could reveal the full extent of its influence on cellular physiology and identify previously unrecognized functions.

  • Single-cell dynamics: Investigating how RexB functions vary at the single-cell level could reveal stochastic aspects of phage exclusion and cell fate determination, potentially uncovering bet-hedging strategies employed by phages.

  • Synthetic biology applications: Engineering RexB variants with modified or enhanced functions could lead to novel tools for controlling protein stability, preventing cell death, or modulating membrane properties in biotechnological applications.

  • Evolutionary studies: Comparative analysis of Rex systems across diverse phages could illuminate the evolutionary history and significance of these genes, potentially revealing new principles of phage-host co-evolution.

  • Integration with structural and computational approaches: Combining experimental data with structural modeling and computational simulations could help resolve the molecular mechanisms underlying RexB's diverse functions.

  • Investigation of potential medical applications: Understanding how RexB modulates bacterial physiology could potentially inform the development of novel antibacterial strategies or improvements in phage therapy approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.