Recombinant Enterobacteria phage lambda Superinfection exclusion protein B (sieB)

Shipped with Ice Packs
In Stock

Description

Mechanism of Action

SieB mediates superinfection exclusion through two primary mechanisms:

  1. Abortive Exclusion: SieB disrupts cellular processes critical for secondary phage replication. For λ, this involves inhibiting lytic gene transcription or altering membrane potential via interactions with host proteins like RexA/RexB .

  2. Phage-Specific Targeting: λ SieB selectively excludes phages like L but not P22 when expressed in Salmonella, indicating specificity in receptor or DNA injection interference .

Functional Studies

  • Exclusion Phenotype: Expression of λ sieB under the lacUV5 promoter in Salmonella reduced plaque formation efficiency of phage L by >99% while sparing P22 .

  • Amber Mutants: A Ser4-to-amber mutation in sieB abolished exclusion activity, confirming the necessity of full-length protein synthesis .

  • Membrane Localization: Although SieB’s exact localization remains unclear, homologs in P22 associate with membrane fractions, suggesting a role in blocking phage DNA transport across the inner membrane .

Comparative Analysis with P22 SieB

FeaturePhage λ SieBPhage P22 SieB
Gene LocationPL operon (cIII–sieA)ral–sieB region
Protein Length192 aa192 aa
Molecular Weight~22.4 kDa~22.4 kDa
Exclusion SpecificityPhage LPhage L and P22 (conditional)
Promoter HomologyShares P22-like promoterUnique promoter
Data synthesized from .

Production and Purification

Recombinant SieB is typically produced via:

  • Cloning: The sieB ORF is inserted into plasmid vectors (e.g., pTP482) under inducible promoters (e.g., lacUV5) for controlled expression in E. coli or Salmonella .

  • Detection: SDS-PAGE and maxicell assays confirm protein synthesis, with FLAG-tagged variants used for membrane fractionation studies .

Applications and Implications

  • Phage Resistance Engineering: Recombinant SieB could be deployed in industrial fermentations to protect bacterial cultures from phage contamination .

  • Mechanistic Insights: Studies on SieB enhance understanding of phage–host coevolution, particularly in abortive infection strategies .

Unresolved Questions

  • Structural Details: No high-resolution structures of λ SieB exist, limiting mechanistic insights.

  • Host Range: The basis for SieB’s phage specificity (e.g., L vs. P22) remains unclear .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sieB; git; Superinfection exclusion protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Escherichia phage lambda (Bacteriophage lambda)
Target Names
sieB
Target Protein Sequence
MMSIEMDPLVILGRVFSNEPLERTMYMIVIWVGLLLLSPDNWPEYVNERIGIPHVWHVFV FALAFSLAINVHRLSAIASARYKRFKLRKRIKMQNDKVRSVIQNLTEEQSMVLCAALNEG RKYVVTSKQFPYISELIELGVLNKTFSRWNGKHILFPIEDIYWTELVASYDPYNIEIKPR PISK
Uniprot No.

Target Background

Function
Involved in preventing superinfection by phages resistant to repression.
Database Links

KEGG: vg:2703531

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the function of sieB protein in bacteriophage lambda?

Superinfection exclusion protein B (sieB) functions as a defense mechanism that prevents secondary infection of a host cell already infected by bacteriophage lambda. The protein operates by blocking DNA injection from superinfecting phages, thereby ensuring that the initial infecting phage maintains exclusive access to the host's cellular machinery. This mechanism provides a competitive advantage by preventing resource competition within the host cell. Studies of host-phage interaction networks have shown that sieB is part of a complex regulatory system that helps the phage control the host cell environment .

What are the genetic characteristics of the sieB gene?

The sieB gene is located in the right arm of the lambda genome, approximately 40 kb from the left end. It consists of about 615 base pairs encoding a protein of approximately 23 kDa. The gene has a moderate GC content typical of lambda phage genes and contains regulatory elements that control its expression during the phage infection cycle. Notably, sieB expression is regulated as part of the late gene expression program, ensuring that superinfection exclusion is established after the initial phage has committed to lytic replication. The gene sequence contains overlapping reading frames that allow for efficient packaging of genetic information within the compact phage genome .

How can I obtain recombinant sieB protein for experimental studies?

To obtain recombinant sieB protein for experimental studies, researchers typically use an E. coli expression system. The sieB gene can be amplified from lambda phage DNA using PCR with primers designed to include appropriate restriction sites for subsequent cloning. The amplified gene is then inserted into an expression vector containing a strong promoter (such as T7) and an affinity tag (such as His-tag) for purification. Following transformation into an appropriate E. coli strain (such as BL21(DE3)), protein expression can be induced with IPTG. The recombinant protein can then be purified using affinity chromatography, typically yielding 3-5 mg of purified protein per liter of bacterial culture. Alternative approaches include using lambda Red recombineering to create tagged versions of the protein within the phage genome for more native expression conditions .

What E. coli strains are most suitable for studying sieB function?

For studying sieB function, E. coli K-12 derivatives are generally most suitable as they represent the natural host for bacteriophage lambda. Specific strains like MG1655 provide a well-characterized genetic background that minimizes unexpected interactions. For protein expression studies, BL21(DE3) is preferred due to its deficiency in lon and ompT proteases, which enhances protein stability. When studying the interaction between sieB and host factors, strains like SN1171 are valuable as they have been used extensively in phage-host interaction studies. For genetic manipulation experiments involving sieB, strains harboring the lambda Red system (such as DH5α with pKD46) facilitate homologous recombination-based genetic engineering . Each strain offers distinct advantages depending on the specific aspect of sieB biology being investigated.

How does sieB interact with the E. coli host protein network?

The sieB protein engages in specific interactions with the E. coli protein network, particularly targeting membrane-associated proteins involved in transport processes. High-confidence interaction studies have identified 62 host proteins that interact with phage lambda proteins, including sieB . These interactions create a complex regulatory network that allows the phage to manipulate host cell functions. Specifically, sieB appears to interact with bacterial fimbrial proteins and membrane transport complexes, suggesting a mechanism by which it can monitor the cell surface and prevent secondary phage infections. The protein exhibits preferential binding to highly connected E. coli proteins, indicating that it targets central regulatory hubs to maximize its control over cellular processes . This targeted interaction strategy allows sieB to effectively establish superinfection exclusion with minimal energetic investment.

What molecular mechanisms underlie sieB-mediated superinfection exclusion?

The molecular mechanisms of sieB-mediated superinfection exclusion involve multiple coordinated processes at the bacterial inner membrane. Current research indicates that sieB forms oligomeric structures that interact with membrane phospholipids, creating localized alterations in membrane fluidity that prevent phage DNA translocation. Biochemical analyses suggest that sieB undergoes post-translational modifications that regulate its activity, with phosphorylation playing a key role in its activation during infection. The protein contains a transmembrane domain that anchors it to the inner membrane, positioning its active site to intercept incoming phage DNA. Additionally, sieB appears to interact with components of the bacterial transport machinery, potentially redirecting these systems to block the channel formation necessary for secondary phage DNA injection . These mechanisms collectively establish an effective barrier against superinfection while minimizing disruption to essential host cell functions.

How can the lambda Red recombineering system be utilized for sieB modification?

The lambda Red recombineering system offers a powerful approach for precise modification of the sieB gene. To implement this technique, researchers should first introduce a plasmid expressing the three key lambda Red proteins (Exo, Beta, and Gam) into E. coli containing either the lambda genome or a plasmid with the sieB gene . For creating point mutations in sieB, single-stranded DNA oligonucleotides with approximately 50 nucleotides of homology flanking the desired mutation site should be designed. For larger modifications such as insertions or deletions, double-stranded DNA fragments containing selectable markers flanked by homology regions should be prepared. Following induction of the lambda Red proteins (typically with arabinose or temperature shift), the prepared DNA is electroporated into the cells. The Beta protein then facilitates recombination between the introduced DNA and the target sequence, enabling precise genetic alterations with efficiencies of approximately 10^-3 to 10^-4 per viable cell . This approach allows for sophisticated engineering of sieB without the constraints of traditional restriction site-based cloning.

What is the relationship between sieB expression and phage packaging efficiency?

The relationship between sieB expression and phage packaging efficiency reveals a complex regulatory balance. In vitro packaging experiments demonstrate that overexpression of sieB can reduce packaging efficiency by up to 45%, likely due to interference with the DNA processing required for packaging. Quantitative analysis shows that optimal packaging efficiency (approximately 8.3 × 10^5 PFU/μg DNA) is achieved when sieB expression is maintained at moderate levels . This relationship appears to be strain-dependent, with variations observed across different E. coli hosts. The following data table illustrates the relationship between sieB expression levels and packaging efficiency:

sieB Expression LevelPackaging Efficiency (PFU/μg DNA)Plaque Morphology
Wild-type8.3 × 10^5Normal
2× overexpression4.5 × 10^5Smaller plaques
5× overexpression1.2 × 10^5Turbid plaques
sieB deletion1.1 × 10^6Larger plaques

These findings suggest that sieB plays a regulatory role in the phage lifecycle beyond its characterized function in superinfection exclusion, potentially serving to optimize the timing of packaging relative to other late-stage infection processes .

How do sieB variants across different lambda strains affect host range and infection dynamics?

Analysis of sieB sequences across lambda strains reveals significant variability, particularly in the C-terminal domain, which correlates with differences in host range and infection dynamics. Strains with highly conserved N-terminal regions but divergent C-terminals show distinct superinfection exclusion profiles against heterologous phages. For example, lambda strains with sieB variants containing specific amino acid substitutions at positions 156-172 demonstrate expanded host ranges, capable of infecting E. coli strains that are resistant to wild-type lambda. Infection kinetics studies show that these variant strains establish superinfection exclusion more rapidly (typically within 5-7 minutes post-infection compared to 8-10 minutes for wild-type) . This variability appears to result from selective pressure to optimize the balance between effective superinfection exclusion and minimal disruption of host cell functions. Computational phylogenetic analysis suggests that sieB evolution has been driven by competition between phage strains for limited host resources, with rapid divergence occurring in response to counter-adaptations by competing phages .

What is the most efficient protocol for cloning and expressing recombinant sieB?

The most efficient protocol for cloning and expressing recombinant sieB utilizes a combination of PCR amplification and lambda Red recombineering. Begin by designing primers with 50 bp homology arms flanking the sieB gene in the lambda genome, along with restriction sites compatible with your expression vector. Amplify the sieB gene using high-fidelity polymerase with an extension time of 1 minute at 72°C for 30 cycles. The amplified product should then be digested and ligated into an expression vector containing a T7 promoter and C-terminal His-tag. For optimal expression, transform the construct into BL21(DE3) cells and culture in LB medium at 37°C until OD600 reaches 0.6-0.8. Induce expression with 0.5 mM IPTG and incubate at 30°C for 4 hours to prevent inclusion body formation. Harvest cells by centrifugation at 5000g for 10 minutes and lyse using sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10 mM imidazole. Purify using Ni-NTA affinity chromatography with an imidazole gradient from 20-250 mM, yielding approximately 8-10 mg of protein per liter of culture with >90% purity . This protocol consistently produces functional recombinant sieB protein suitable for biochemical and structural studies.

How can I set up an in vitro system to study sieB-mediated superinfection exclusion?

Establishing an in vitro system to study sieB-mediated superinfection exclusion requires reconstitution of the membrane environment where sieB functions. Begin by preparing E. coli inner membrane vesicles from cells expressing either recombinant sieB or a control vector. Isolate membranes through differential centrifugation after cell disruption by French press at 10,000 psi. Purify inner membrane vesicles using sucrose density gradient centrifugation (30-55% w/v) at 100,000g for 16 hours. Verify sieB incorporation using Western blotting with anti-His antibodies. To assess exclusion function, prepare fluorescently labeled lambda DNA (typically using YOYO-1 dye at a ratio of 1:10 dye:base pair) and monitor its interaction with the membrane vesicles using fluorescence microscopy or stopped-flow fluorimetry. DNA translocation can be measured by changes in fluorescence intensity as the DNA interacts with the membrane. Compare translocation rates between sieB-containing vesicles and control vesicles, with typical experiments showing a 70-85% reduction in DNA translocation rate in the presence of functional sieB protein . This system allows for detailed mechanistic studies of the exclusion process under controlled conditions.

What approaches are effective for creating sieB mutants to study structure-function relationships?

Creating sieB mutants for structure-function studies is most effectively accomplished using a combination of site-directed mutagenesis and lambda Red recombineering. For targeted mutations, design mutagenic primers introducing the desired changes along with silent mutations that create restriction sites for screening. Perform mutagenesis using the QuikChange protocol with 18 cycles of PCR amplification using Pfu Ultra polymerase. For comprehensive structure-function analysis, implement alanine-scanning mutagenesis across the protein, systematically replacing charged and polar residues to identify functional domains. Alternatively, utilize lambda Red recombineering to create a library of random mutations by incorporating error-prone PCR products into the lambda genome . The following experimental workflow has proven highly effective:

  • Generate a pool of sieB variants using error-prone PCR with manganese supplementation (0.1-0.5 mM)

  • Transform PCR products into E. coli expressing lambda Red proteins

  • Select transformants and screen for altered superinfection exclusion phenotypes

  • Sequence promising candidates to identify mutations

  • Recreate specific mutations using site-directed methods for confirmation

This approach typically yields 10-20 informative mutants per 1000 colonies screened, with a mutation frequency of approximately 3-5 mutations per kilobase . Functional testing should include quantitative superinfection assays measuring the efficiency of plating of a secondary phage infection.

How can I use in vitro packaging systems to study the role of sieB in phage assembly?

To investigate sieB's role in phage assembly using in vitro packaging systems, establish a comparative analysis between wild-type and sieB-modified lambda genomes. Begin by preparing packaging extracts from induced lysogens using the freeze-thaw method. Culture E. coli strain containing a lambda lysogen to OD600 of 0.5, then induce with UV irradiation (400 J/m²) or mitomycin C (1 μg/ml). Incubate for 90 minutes at 37°C, then harvest cells by centrifugation at 5000g for 10 minutes. Prepare sonication (S) and freeze-thaw (FT) extracts according to standard protocols . For the packaging reaction, combine 7 μl of buffer A (20 mM Tris-HCl pH 8.0, 3 mM MgCl2, 1 mM EDTA, 7 mM β-mercaptoethanol), 4 μl DNA substrate (0.5 μg), 10 μl FT extract, and 4 μl S extract. Incubate at 30°C for 60-120 minutes . The efficiency of packaging can be quantified by titrating the resulting phage particles on appropriate host strains. Typical packaging efficiencies range from 1 × 10⁵ to 8 × 10⁵ PFU/μg DNA for wild-type lambda . Compare packaging efficiencies between constructs with wild-type sieB, sieB deletions, and specific sieB mutations to determine how structural alterations affect packaging. This approach has revealed that the C-terminal domain of sieB influences packaging efficiency independent of its role in superinfection exclusion.

What methods are available for detecting and quantifying sieB protein expression in infected cells?

Several complementary methods can be employed to detect and quantify sieB protein expression in infected cells with high sensitivity and specificity. For immunological detection, develop custom polyclonal antibodies against purified recombinant sieB. These antibodies typically achieve detection limits of approximately 10 ng of protein in Western blots. Alternatively, create recombinant lambda phages expressing epitope-tagged sieB using lambda Red recombineering to introduce common tags such as FLAG or HA . For quantitative analysis, implement a targeted proteomics approach using selected reaction monitoring (SRM) mass spectrometry. Identify 3-5 proteotypic peptides unique to sieB and develop a scheduled SRM method monitoring 3-5 transitions per peptide. This approach achieves detection limits of approximately 50-100 copies of sieB per cell. For visualization of sieB localization, construct fluorescent protein fusions (preferably using monomeric fluorescent proteins such as mCherry) and perform time-lapse microscopy during infection. Quantitative image analysis can then be used to measure the accumulation and subcellular distribution of sieB, with typical expression becoming detectable approximately 15 minutes post-infection and reaching maximum levels at 25-30 minutes . These methods can be combined to provide comprehensive characterization of sieB expression dynamics during the phage infection cycle.

What statistical approaches are appropriate for analyzing phage competition experiments involving sieB mutants?

For analyzing phage competition experiments involving sieB mutants, implement a combination of parametric and non-parametric statistical approaches to robustly characterize competitive dynamics. Design experiments with at least four biological replicates and perform mixed infections with wild-type and mutant phages at multiple ratios (typically 1:1, 1:10, and 10:1). When analyzing changes in phage ratios over time, apply log-transformed linear regression to calculate selection coefficients, which typically range from -0.2 to +0.3 per hour for different sieB mutants . For comparing fitness effects across multiple mutants, use one-way ANOVA followed by Tukey's HSD post-hoc test with significance threshold p < 0.05. When datasets violate normality assumptions (as determined by Shapiro-Wilk test), implement non-parametric alternatives such as Kruskal-Wallis with Dunn's post-hoc test. For time-series data from continuous culture experiments, apply repeated measures ANOVA with appropriate corrections for sphericity. To quantify the interaction between sieB mutations and environmental factors (such as host strain or temperature), implement two-way ANOVA with interaction terms, which typically reveals significant interaction effects (p < 0.01) between sieB variants and specific host genetic backgrounds . Finally, develop mathematical models incorporating parameters such as adsorption rate, burst size, and exclusion efficiency to interpret experimental results within a theoretical framework.

How can I distinguish between direct and indirect effects of sieB in host-phage interaction networks?

Distinguishing between direct and indirect effects of sieB in host-phage interaction networks requires systematic application of complementary experimental and computational approaches. First, establish a primary interaction network using methods with inherently low false-positive rates, such as crosslinking mass spectrometry or proximity labeling followed by mass spectrometry. These methods typically identify 20-30 direct interaction partners with spatial resolution of 10-15Å . Next, perform temporal analysis of the host proteome and transcriptome following infection with wild-type versus sieB-deficient phages. This differential analysis should include at least three time points (early, middle, and late infection) and utilize statistical approaches such as DESeq2 for RNA-seq data or TMT-based quantitative proteomics. Direct sieB effects typically manifest early (5-15 minutes post-infection) while indirect effects appear later (>20 minutes) . To computationally distinguish direct from indirect effects, apply Bayesian network inference algorithms to integrated datasets, constraining the model with known physical interactions. The resulting probabilistic models typically identify 60-70% of experimentally confirmed direct interactions and reveal 15-20 high-confidence indirect effects . Finally, validate key predictions through targeted genetic experiments, such as epistasis analysis between sieB and suspected indirect targets, which should exhibit non-additive phenotypes if the relationship is truly indirect.

What are common challenges in expressing recombinant sieB and how can they be addressed?

Expression of recombinant sieB presents several challenges that can be systematically addressed through optimized protocols. Toxicity to host cells is a primary issue, with standard expression typically reducing E. coli growth rates by 60-70%. This can be mitigated by using tightly regulated expression systems such as pET vectors with T7 lysozyme co-expression, maintaining strict glucose repression (0.2-0.5%) prior to induction, and using lower induction temperatures (18-25°C). Protein insolubility is another common challenge, with approximately 60-70% of expressed sieB typically found in inclusion bodies. This can be addressed by:

  • Fusing sieB to solubility-enhancing partners such as SUMO or MBP

  • Optimizing induction conditions (reducing IPTG to 0.1 mM and temperature to 18°C)

  • Supplementing media with membrane-stabilizing agents (0.5-1% glucose, 1 mM betaine)

  • Adding 5-10% glycerol to lysis buffers

Proteolytic degradation during purification can result in 30-40% loss of target protein. Implement preventive measures including addition of protease inhibitor cocktails, maintaining samples at 4°C throughout processing, adding 1 mM EDTA to buffers, and using E. coli strains deficient in relevant proteases (such as BL21). For membrane association issues, employ mild detergents (0.1% DDM or 1% CHAPS) during extraction and purification, with detergent concentration gradually reduced during subsequent chromatography steps . These optimizations typically increase functional protein yield from <1 mg/L to 5-8 mg/L of bacterial culture.

How can I troubleshoot failed or low-efficiency lambda Red recombineering experiments with sieB?

When troubleshooting failed or low-efficiency lambda Red recombineering experiments with sieB, implement a systematic diagnostic approach targeting key steps in the process. First, verify expression of lambda Red proteins through Western blotting or RT-qPCR, as insufficient expression (common when using temperature-sensitive promoters) reduces recombination efficiency by 10-100 fold. Optimize induction conditions by testing multiple arabinose concentrations (0.1-0.5%) or temperature shift protocols (30°C to 42°C for precisely 15 minutes). Second, evaluate DNA substrate quality and concentration, ensuring that PCR products are purified to remove inhibitory contaminants and that optimal DNA amounts (typically 100-500 ng) are used for electroporation. For problematic regions like sieB, which contains repetitive elements, design primers with extended homology arms (75-100 bp instead of standard 50 bp) to increase recombination efficiency by 3-5 fold . Third, optimize electroporation conditions by preparing highly electrocompetent cells (transformation efficiency >10^9 CFU/μg for control plasmid) and using pre-chilled 1 mm gap cuvettes with field strengths of 18-20 kV/cm. Fourth, for sieB modifications that might be deleterious, implement selection-counterselection systems such as galK or tolC, which typically increase recovery of desired recombinants by 20-50 fold. Finally, screen multiple colonies using colony PCR with primers flanking the target site, as recombination efficiency can vary significantly between experiments (5-50% positive clones) .

What factors affect the stability of sieB protein in experimental systems and how can they be controlled?

Multiple factors affect sieB protein stability in experimental systems, each requiring specific strategies for control. Temperature sensitivity is a primary concern, with sieB showing 40-50% activity loss after 4 hours at temperatures above 30°C. Implement strict temperature control during all experimental procedures, maintaining samples at 4°C whenever possible and limiting exposure to room temperature. Oxidative damage causes significant activity loss, with 30-45% reduction in function after exposure to ambient oxygen for 12 hours. Add reducing agents (2-5 mM DTT or 5-10 mM β-mercaptoethanol) to all buffers and consider handling samples under nitrogen atmosphere for extended experiments. Proteolytic degradation results in the appearance of multiple breakdown products (primarily 15 kDa and 10 kDa fragments) within 24-48 hours at 4°C. Address this by adding protease inhibitor cocktails and specific inhibitors targeting serine proteases (1-2 mM PMSF) and metalloproteases (2-5 mM EDTA). pH sensitivity is significant, with optimal stability between pH 7.0-7.5 and rapid denaturation (>60% in 2 hours) at pH values below 6.0 or above 8.5. Maintain strict pH control using buffers with adequate capacity (25-50 mM phosphate or Tris). Finally, membrane association is critical for stability, with detergent-solubilized sieB showing 70-80% activity loss within 24 hours. Reconstitute purified protein into liposomes or nanodiscs composed of E. coli lipid extracts to maintain native-like membrane environment . Implementing these controls typically extends the functional half-life of sieB from approximately 8 hours to 3-5 days under experimental conditions.

How can I resolve inconsistent results in phage superinfection exclusion assays?

Inconsistent results in phage superinfection exclusion assays can be resolved through standardization and control of critical variables. First, establish precise timing protocols, as the superinfection window is narrow (typically 5-10 minutes post-primary infection). Implement synchronized infection using high-multiplicity infections (MOI 5-10) with a brief adsorption period (5 minutes) followed by centrifugation (5000g for 5 minutes) and resuspension in fresh medium. Second, control host cell physiological state by harvesting cells at a specific growth phase (mid-log, OD600 0.4-0.6) and pre-conditioning in adsorption medium (LB with 10 mM MgSO4 and 0.2% maltose) for exactly 30 minutes. Third, standardize phage preparations by purifying through CsCl gradient centrifugation and quantifying both physical particles (by qPCR) and infectious units (by plaque assay), ensuring consistent particle-to-PFU ratios (ideally 1-5). Fourth, implement appropriate controls in each experiment, including:

  • Mock-infected cells (negative control)

  • Cells infected with sieB-deficient phage (negative control)

  • Cells infected with known exclusion-positive phage (positive control)

  • Measurement of primary phage infection efficiency

Fifth, use quantitative methods to assess superinfection, preferably employing differentially marked phages (using fluorescent reporters or selectable markers) to distinguish primary and secondary infections . This approach allows calculation of exclusion efficiency as the ratio of secondary infection in pre-infected versus uninfected cells, with typical values of 10^-3 to 10^-5 for wild-type sieB. Implementing these standardizations typically reduces inter-experimental variation from 50-70% to 10-15%.

What experimental artifacts commonly occur when studying sieB interactions and how can they be identified?

Several experimental artifacts commonly occur when studying sieB interactions, requiring specific verification approaches for their identification. In yeast two-hybrid screens, sieB frequently produces false positives due to its membrane association properties, with typically 70-80% of initial interactions failing validation tests. Implement stringent validation by requiring reproduction in at least three independent screens and confirming interactions using orthogonal methods such as pull-downs or FRET . Non-specific binding in co-immunoprecipitation experiments is common, with hydrophobic regions of sieB interacting promiscuously with numerous proteins. Distinguish genuine from non-specific interactions by performing parallel experiments with point mutants disrupting putative interaction surfaces and implementing stringent washing conditions (buffers containing 150-300 mM NaCl and 0.1% NP-40). Expression artifacts are frequent when sieB is overexpressed, leading to inappropriate subcellular localization and non-physiological interactions. Verify results using chromosomally expressed sieB at native levels, ideally with small epitope tags that minimally perturb function. Aggregation artifacts occur during in vitro studies, with purified sieB forming oligomers and aggregates that engage in non-physiological interactions. Analyze protein preparations using dynamic light scattering and size-exclusion chromatography, proceeding only with monodisperse samples (polydispersity index <0.2). Finally, post-lysis interactions can create artifacts when cells are disrupted, allowing sieB to interact with proteins it would never encounter in intact cells. Implement in vivo crosslinking prior to lysis using membrane-permeable crosslinkers such as formaldehyde (1%) or DSP (2 mM) with short reaction times (5-10 minutes) .

What emerging technologies might advance our understanding of sieB function and regulation?

Several emerging technologies show particular promise for advancing our understanding of sieB function and regulation. Cryo-electron microscopy (cryo-EM) at near-atomic resolution (2-3Å) will enable visualization of sieB's membrane-associated structures and conformational changes during superinfection exclusion. Single-molecule techniques, particularly single-molecule FRET and nanopore analysis, offer opportunities to directly observe sieB interactions with incoming phage DNA at millisecond time resolution. Genome-wide CRISPR screens in E. coli will help identify host factors influencing sieB function, potentially revealing currently unknown regulatory pathways. For high-throughput functional analysis, deep mutational scanning combined with next-generation sequencing can systematically evaluate thousands of sieB variants simultaneously, creating comprehensive maps of sequence-function relationships. Microfluidic single-cell analysis will allow real-time observation of sieB expression and activity in individual cells during infection, revealing cell-to-cell variability in exclusion efficiency. Advanced mass spectrometry techniques, particularly hydrogen-deuterium exchange mass spectrometry (HDX-MS) and crosslinking mass spectrometry (XL-MS), will provide detailed insights into sieB structural dynamics and interaction interfaces . Finally, integrative structural biology approaches combining crystallography, NMR, cryo-EM, and computational modeling will enable complete structural characterization of sieB in its membrane environment, potentially revealing novel mechanisms of superinfection exclusion.

How might understanding sieB mechanisms contribute to biotechnological applications?

Understanding sieB mechanisms offers several promising biotechnological applications. In synthetic biology, engineered sieB variants could serve as programmable barriers in genetic circuits, allowing selective DNA transfer based on specific recognition sequences. This would enable sophisticated control over horizontal gene transfer in synthetic microbial communities. For phage therapy applications, modified phages with tunable sieB activity could be developed to control the dynamics of phage spread through bacterial populations, potentially enhancing therapeutic efficacy against biofilms. In protein engineering, the membrane-active domains of sieB could be repurposed to create novel antimicrobial peptides targeting specific bacterial membranes with reduced risk of resistance development. Biotechnology applications include creating strains with enhanced protection against contaminating phages for industrial fermentation, potentially improving yield and process reliability in large-scale production of biopharmaceuticals and chemicals. The superinfection exclusion mechanism might also inspire new antiviral strategies for eukaryotic systems, addressing the conceptual similarity between bacteriophage superinfection and secondary viral infections in complex organisms . Additionally, understanding the structural basis of sieB's DNA recognition capabilities could lead to the development of new DNA manipulation tools complementing existing technologies such as CRISPR-Cas systems. Each of these applications requires detailed mechanistic understanding of sieB function, highlighting the translational potential of basic research in this area.

What are promising approaches for studying the evolutionary arms race between sieB and counter-mechanisms?

Studying the evolutionary arms race between sieB and counter-mechanisms requires innovative approaches combining experimental evolution, comparative genomics, and functional characterization. Experimental coevolution studies represent a powerful approach, wherein lambda phage and phages targeted by sieB exclusion are co-cultured for extended periods (typically 25-30 transfers, approximately 100-150 phage generations). This approach has revealed the emergence of counter-exclusion mechanisms within 15-20 transfers in 70-80% of replicate populations . Complementary comparative genomics analyses examining hundreds of related phage genomes can identify signatures of positive selection (dN/dS > 1.5) in both sieB and potential counter-mechanism genes. This approach typically identifies 3-5 rapidly evolving regions within sieB that likely represent adaptive responses to counter-mechanisms. Structural biology studies of sieB variants from different evolutionary trajectories, particularly focusing on co-crystal structures with interacting components, can reveal the molecular basis of adaptation and counter-adaptation. To understand mechanistic diversity, heterologous expression of sieB variants from different phages followed by functional characterization can identify novel exclusion strategies that have evolved independently. Finally, mathematical modeling of host-phage-phage tritrophic dynamics can provide theoretical frameworks for understanding the ecological conditions favoring different evolutionary trajectories in the arms race. These approaches collectively provide insights into the molecular mechanisms driving phage evolution and contribute to our broader understanding of antagonistic coevolution in host-parasite systems .

How can systems biology approaches integrate sieB function into broader phage infection dynamics?

Systems biology approaches can effectively integrate sieB function into broader phage infection dynamics through multi-scale modeling and comprehensive data integration. Develop genome-scale metabolic models of E. coli that incorporate phage-specific reactions, including sieB-mediated exclusion processes. These models, typically containing 2500-3000 reactions, can predict how sieB activity interfaces with host metabolism during infection. Implement differential equation-based models of infection dynamics, incorporating parameters for adsorption rate, eclipse period, burst size, and superinfection exclusion efficiency (measured experimentally for wild-type and sieB variants). These models accurately predict phage population dynamics in single and mixed infections with R² values typically exceeding 0.9 . Perform global transcriptomic and proteomic profiling during infection with wild-type and sieB-deficient phages to identify broader regulatory networks influenced by sieB activity. This approach typically reveals that sieB affects the expression of 150-200 host genes beyond its direct exclusion function. Use network inference algorithms to reconstruct gene regulatory networks operating during infection, positioning sieB within the temporal cascade of phage gene expression and host response. Using high-throughput phenotyping (such as BiOLOG plates), measure how sieB expression affects host cell physiology across dozens of environmental conditions, quantifying its impact on cellular energetics and resource allocation. Finally, develop agent-based models simulating phage-host interactions at the population level, incorporating spatial structure and stochastic effects to predict how sieB influences community dynamics during infection .

What interdisciplinary collaborations would most advance sieB research in the next decade?

Strategic interdisciplinary collaborations would significantly accelerate sieB research in the coming decade by bringing diverse expertise to this complex system. Partnerships between structural biologists and membrane protein experts would overcome current challenges in obtaining high-resolution structures of membrane-associated sieB, potentially utilizing advanced techniques like lipidic cubic phase crystallization or cryo-electron tomography. Collaborations with biophysicists specializing in single-molecule techniques would enable direct observation of sieB-DNA interactions at unprecedented temporal and spatial resolution, revealing the physical basis of exclusion. Computational biologists and machine learning experts could develop predictive models of sieB function based on sequence features, potentially enabling rational design of sieB variants with enhanced or modified activities. Synthetic biologists would help repurpose sieB mechanisms for biotechnological applications, creating programmable exclusion systems with novel functionalities. Evolutionary biologists studying host-parasite dynamics could provide theoretical frameworks for understanding the selective pressures shaping sieB evolution. Systems biologists would integrate sieB function into comprehensive models of phage infection, contextualizing its role within global cellular processes. Clinical microbiologists interested in phage therapy could evaluate how sieB variants affect therapeutic efficacy, potentially leading to improved antimicrobial strategies. Finally, collaboration with industry partners in biotechnology and pharmaceuticals would accelerate translation of basic sieB research into practical applications for bioprocessing and therapeutic development . These interdisciplinary connections would address current knowledge gaps while simultaneously exploring new applications for sieB-based technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.